KEGG   Micrococcus luteus: Mlut_09820Help
Entry
Mlut_09820        CDS       T00918                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mlu  Micrococcus luteus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Mlut_09820
Enzymes [BR:mlu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Mlut_09820
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Mlut_09820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057036..1057761
Genome map
AA seq 241 aa AA seqDB search
MLHVHLGMYGAWTFGGDQDFAAASSIGAPRRIGEREVHDDGAPAAEPCRDADGWVQPPSP
AATVRLRLRAEHGWADLIGASRCRALTPAEAADVVAGLGPDPLNDDDPAPFYDLARRTRR
PIGVVLMDQAAVSGIGNIFRAEALFRAGIDPWRPAREVSAPDLESLWADNAALMREGVRL
GRIVTTRPEHRPGIPAEAAWPEHANYVYQRQGLACLVCGREAIVVEEMAARKLYRCLTCQ
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgctccacgtgcacctgggcatgtacggggcgtggaccttcggcggggatcaggacttc
gcggccgcgtcctcgatcggcgccccccgccggatcggcgagcgggaggtccacgacgac
ggcgccccggccgccgagccctgtcgcgacgccgacggctgggtccagccgccgtcgccg
gccgccacggtccggctgcgactgcgcgccgagcacggctgggccgacctgatcggcgcg
agccggtgccgcgcactcaccccggccgaggctgccgacgtcgtcgccggtctcggcccg
gatccgctcaacgacgacgatcctgcgccgttctacgacctcgcccggcgcacgcggcgg
ccgatcggcgtcgtgttgatggaccaggcggccgtcagcgggatcggcaacatcttccgg
gccgaggcgctgttccgcgccggcatcgacccgtggcggccggcccgggaggtctctgca
cctgacctggagtccctctgggcggacaacgccgcgctcatgcgggagggcgtgcggctc
gggcggatcgtcaccacgcggcccgagcaccggccggggatccctgccgaagcggcctgg
cccgagcacgcgaactacgtgtaccagcggcagggcctcgcctgcctcgtgtgcgggcgc
gaggcgatcgtggtggaggagatggcggcccggaagctctaccggtgcctcacctgtcag
agctga

DBGET integrated database retrieval system