KEGG   Micrococcus luteus: Mlut_09820Help
Entry
Mlut_09820        CDS       T00918                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mlu  Micrococcus luteus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mlu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057036..1057761
Genome map
AA seq 241 aa AA seqDB search
MLHVHLGMYGAWTFGGDQDFAAASSIGAPRRIGEREVHDDGAPAAEPCRDADGWVQPPSP
AATVRLRLRAEHGWADLIGASRCRALTPAEAADVVAGLGPDPLNDDDPAPFYDLARRTRR
PIGVVLMDQAAVSGIGNIFRAEALFRAGIDPWRPAREVSAPDLESLWADNAALMREGVRL
GRIVTTRPEHRPGIPAEAAWPEHANYVYQRQGLACLVCGREAIVVEEMAARKLYRCLTCQ
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgctccacgtgcacctgggcatgtacggggcgtggaccttcggcggggatcaggacttc
gcggccgcgtcctcgatcggcgccccccgccggatcggcgagcgggaggtccacgacgac
ggcgccccggccgccgagccctgtcgcgacgccgacggctgggtccagccgccgtcgccg
gccgccacggtccggctgcgactgcgcgccgagcacggctgggccgacctgatcggcgcg
agccggtgccgcgcactcaccccggccgaggctgccgacgtcgtcgccggtctcggcccg
gatccgctcaacgacgacgatcctgcgccgttctacgacctcgcccggcgcacgcggcgg
ccgatcggcgtcgtgttgatggaccaggcggccgtcagcgggatcggcaacatcttccgg
gccgaggcgctgttccgcgccggcatcgacccgtggcggccggcccgggaggtctctgca
cctgacctggagtccctctgggcggacaacgccgcgctcatgcgggagggcgtgcggctc
gggcggatcgtcaccacgcggcccgagcaccggccggggatccctgccgaagcggcctgg
cccgagcacgcgaactacgtgtaccagcggcagggcctcgcctgcctcgtgtgcgggcgc
gaggcgatcgtggtggaggagatggcggcccggaagctctaccggtgcctcacctgtcag
agctga

DBGET integrated database retrieval system