KEGG   Methanosarcina mazei Go1: MM_0669Help
Entry
MM_0669           CDS       T00082                                 

Gene name
ilvH
Definition
acetolactate synthase 3 regulatory subunit (EC:2.2.1.6)
Orthology
K01653  
acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
mma  Methanosarcina mazei Go1
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mma00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    MM_0669 (ilvH)
   01230 Biosynthesis of amino acids
    MM_0669 (ilvH)
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MM_0669 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    MM_0669 (ilvH)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    MM_0669 (ilvH)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MM_0669 (ilvH)
Enzymes [BR:mma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     MM_0669 (ilvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(802529..803014)
Genome map
AA seq 161 aa AA seqDB search
MKHTLAVLVENKSGVLSRVASLFSRRGYNIDSLAVGVTEDPDISRITIVVHGDDHVLEQV
TKQLNKLIDVIKVSDIGSDDAVERELALIKVSADVDTRAEIIQIANIFRARIVDVAPKSM
TVEVTGDEGKIQAIEKLLRQFGIKEMVRTGKIAMVRGPKKV
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatacacttgcagtccttgtggaaaataagtcgggtgtgctctccagagttgct
tctctcttttcaaggcgtggatacaatatcgacagccttgcagtgggagtaaccgaagac
cctgacatctcgagaataaccattgttgtgcatggggatgaccatgtgcttgaacaggtt
acaaaacagctcaacaagctcattgatgttatcaaagtctcggatatcggaagcgatgat
gccgttgaaagggaacttgcccttatcaaggtctcagctgatgtggacacaagggcagag
attatccagattgcaaacattttcagggccaggatagttgatgttgcgccgaagtccatg
actgttgaggtaacaggtgatgaaggcaagatccaggcaatcgaaaaactactccgccag
ttcgggatcaaggaaatggtcaggacaggcaagattgcaatggtgcgcgggccaaagaag
gtttaa

DBGET integrated database retrieval system