KEGG   Methanosarcina mazei Go1: MM_1974Help
Entry
MM_1974           CDS       T00082                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mma  Methanosarcina mazei Go1
Brite
Enzymes [BR:mma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MM_1974
Transfer RNA biogenesis [BR:mma03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MM_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2344103..2345770)
Genome map
AA seq 555 aa AA seqDB search
MTLKTEFEMKEADYNRACRNILEKVLAGEIKDEDQLNKVKKDVSKLYHLASLPRNGDIIM
QGTPEEQALIKEFLRRKPVRTISGVAVIAVMTSPAPCPHGVCLPCPGGPNSSFKSPQSYM
GREPAAMRAIQHEFDPYSQVQSRLSQLKEIGHDVEKVELIVMGGTFSARSLDYQEWFTKR
CLEAMNDFTGMEWRDKAWTIGKSLPYVPLEEVQKANETADIRNVGITFETRPDWAREEHV
DEFLRLGGTKVEIGVQSVYDFVLSRMQRGHGVAEIVRANRVLRDSAFKVGFHMMPHLPGA
DSELDLRGFKKLFDDQRFRPDYLKIYPTLVTEGTPLYRMWKSGEYQALSDEEAAELVADI
KAVLPKWVRLQRIQRDIPAHQIFAGVRKSNLRQLAEEKLREKGGKCRCIRCREVGHNSLK
GRRINEKDIELTVESYEACNGKEHFIAFEDLSADVLIGFTRLRFPAEPHREELQGSALIR
ELHVYGSMVPVGKGAKQKEWQHRGYGKELIEHAEKTASESGYGKLSIISGIGAREYYRKL
GYDLDGVYMSKPLKD
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaccctaaagacggaatttgagatgaaagaagctgattacaacagggcctgcaggaac
atccttgaaaaggtgcttgccggggaaataaaagacgaagaccagttaaacaaagtgaaa
aaagatgtgagtaagctgtatcatcttgccagcctgcctagaaatggggatattattatg
cagggcacacctgaggagcaggctctaataaaagagttcctcaggagaaaacccgtaagg
acgatttccggagtcgcggtaattgctgtaatgacctctcctgccccatgccctcacggg
gtttgcctgccctgtccgggaggtccgaattcctcatttaaatcccctcagagctacatg
ggaagggaacctgcagcaatgagagcaattcagcatgaatttgacccttactcccaggtt
cagtccaggctttcccagctaaaagagatagggcatgatgttgaaaaagttgagcttata
gtgatgggaggcactttttcagcacgcagccttgactatcaggaatggtttaccaaacgc
tgccttgaagcaatgaacgattttacaggcatggaatggagggataaagcctggacgatc
ggaaagtccttgccttatgttccgcttgaagaggttcagaaagcaaacgaaacagctgac
atccgaaacgttggcataacctttgagacaagacctgattgggcaagagaagaacatgta
gacgaattcctcaggcttggagggacaaaggtagagattggagtccagagcgtttatgat
tttgtattatcccggatgcagagagggcatggagttgcagaaattgtcagagctaacagg
gtattaagagacagtgcatttaaagtaggctttcacatgatgcctcaccttcctggagcg
gactccgaacttgacctgaggggatttaaaaagctcttcgatgaccagcgtttcaggccg
gattacctgaaaatatatcctacccttgtaaccgaaggcacccccctgtacagaatgtgg
aaatccggagaatatcaggctctttcagacgaagaagctgcagaacttgtcgcagatata
aaggctgtcctgcctaaatgggtaaggcttcagcgcatccagagggatattcctgcccac
cagatctttgcaggcgtgaggaaaagtaacctaaggcagcttgcagaggagaaactccgg
gaaaagggagggaaatgccgctgcatacgctgcagagaggtcggacacaacagcctgaaa
ggaagaaggataaatgaaaaagacatcgagcttactgtggaatcttacgaagcctgtaac
ggtaaagaacacttcatcgcttttgaagacctttcggcagatgtcctgataggttttaca
cgtttgcgtttccctgccgaacctcacagagaagaactgcagggctctgcacttataagg
gaactgcatgtttacggctccatggtgcctgtaggaaaaggcgcaaaacaaaaagaatgg
caacacaggggttatggaaaggaacttattgaacatgcagaaaaaacggcatccgaatcc
ggctacggcaagctttctataattagcggaataggcgcaagggaatattataggaaactg
ggatacgatcttgacggagtatacatgtcaaaacccctgaaggattaa

DBGET integrated database retrieval system