KEGG   Methanococcus maripaludis X1: GYY_08370Help
Entry
GYY_08370         CDS       T01584                                 

Definition
(RefSeq) pyruvate ferredoxin/flavodoxin oxidoreductase, subunit delta
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYY_08370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_08370
   00020 Citrate cycle (TCA cycle)
    GYY_08370
   00620 Pyruvate metabolism
    GYY_08370
   00640 Propanoate metabolism
    GYY_08370
   00650 Butanoate metabolism
    GYY_08370
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GYY_08370
   00680 Methane metabolism
    GYY_08370
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GYY_08370
Enzymes [BR:mmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GYY_08370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1549781..1550038)
Genome map
AA seq 85 aa AA seqDB search
MVNTGTIIYEPGSSANNKTGSWRVFKPVLDQDKCVKCENCYIFCPEGCIQEKDGKFEIDY
DYCKGCLICEKECPVKAIKAEREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacacaggaacaattatttatgaacctggaagttcagcaaacaataaaactgga
agctggagagtattcaaaccagttttagatcaagacaaatgcgtaaaatgtgaaaattgt
tacatcttctgtcctgaaggctgtatccaagaaaaagatggaaaatttgaaattgactac
gactactgtaaaggatgcctaatttgcgagaaagaatgtcctgtaaaagctataaaagca
gaaagggaagaaaaataa

DBGET integrated database retrieval system