KEGG   Mycobacterium marinum: MMAR_3411Help
Entry
MMAR_3411         CDS       T00694                                 

Gene name
pfkA_1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_3411 (pfkA_1)
   01230 Biosynthesis of amino acids
    MMAR_3411 (pfkA_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_3411 (pfkA_1)
   00030 Pentose phosphate pathway
    MMAR_3411 (pfkA_1)
   00051 Fructose and mannose metabolism
    MMAR_3411 (pfkA_1)
   00052 Galactose metabolism
    MMAR_3411 (pfkA_1)
  Energy metabolism
   00680 Methane metabolism
    MMAR_3411 (pfkA_1)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MMAR_3411 (pfkA_1)
Protein phosphatases and associated proteins [BR:mmi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MMAR_3411 (pfkA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4209643..4210776)
Genome map
AA seq 377 aa AA seqDB search
MNSPIKRVAISTGGGDAPGLNAVIHAATLAARNRGWDVVGIRDGLNGLLLPEDYPEGGLI
ELTRDRVRGIIHQGGTIIGTTNRGNPTAYPVRQSDGSWAEVDRTEELLGRFAQHQIDALI
LVGGDGSMSIGQHLHQSGLPLVGVPKTIDNDLDKTTSTFGFDSAVDFASECIDRLFTTAT
SHGRIIVVEVMGRYAGWIALNAGMASGVHAILIPEIPFSLEPVAAVITDREQRGAKFSIV
CVAEGAKPIGGEVTILGKSVGQAERLGGIGAKVAAELERMTGREARTVVLGHLLRGGSPT
SFDRLLGLRFGAAAVRALDEGHYGVMVALNPPTVDYVPLADATHRQKVVPLDCDSILTAR
DMGINFGDEMPTHSTID
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccccgataaagcgagtcgcgatcagcaccggtggcggggacgcgccgggactc
aatgcggtgatccacgcggccactcttgccgcgcgaaaccgcggctgggacgtggtcggg
atccgagacggcctcaatgggctgttgctgcccgaggactatcccgagggcggcctgatc
gagctcacccgcgaccgggttcgcgggatcatccaccagggcggcacgatcatcggcacg
accaatcggggcaacccgaccgcctacccggtgcggcagagcgacggtagctgggccgaa
gtggaccgcaccgaagagctactgggccgattcgcgcagcaccagatcgatgcgctgatc
ctggtgggcggcgacgggtcgatgtcgatcggccagcatctgcaccagtcggggttaccg
ctggtcggcgtacccaagaccatcgacaatgacctggacaagacgacgtccacattcggc
ttcgacagcgcggtcgacttcgcctccgagtgcatcgaccggctcttcaccaccgcgacc
tcccacggccggatcatcgtggtggaggtgatgggccggtacgcgggatggatcgccctg
aacgccggcatggcctcgggggtgcacgcgatcctcatccccgagatcccgttcagtctg
gagccggtggcagctgtgatcaccgatcgcgaacagcgcggcgcgaaattctcgatagtc
tgcgtcgccgagggggccaagccgatcggcggcgaggtcaccatcctgggcaagtcggtg
gggcaggccgaacgcctcggtggcatcggcgccaaggtggccgccgagctggaacgcatg
accggccgcgaagcacgcacggtggtattgggtcacctgctgcggggcggctcgcccacc
tcgttcgaccggctactgggactgcgcttcggcgccgccgccgtgcgggctctcgatgag
gggcactacggcgtcatggtggcgctgaacccgccgacggtggactacgtaccgcttgcc
gacgccacccatcggcagaaggtcgttccgctcgattgcgactcgatcctgaccgcgcgc
gacatggggatcaacttcggcgacgagatgcccacccacagcaccatcgattag

DBGET integrated database retrieval system