KEGG   Mycobacterium marinum M: MMAR_3411Help
Entry
MMAR_3411         CDS       T00694                                 

Gene name
pfkA_1
Definition
(GenBank) 6-phosphofructokinase PfkA_1
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00010  Glycolysis / Gluconeogenesis
mmi00030  Pentose phosphate pathway
mmi00051  Fructose and mannose metabolism
mmi00052  Galactose metabolism
mmi00680  Methane metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_3411 (pfkA_1)
   00030 Pentose phosphate pathway
    MMAR_3411 (pfkA_1)
   00051 Fructose and mannose metabolism
    MMAR_3411 (pfkA_1)
   00052 Galactose metabolism
    MMAR_3411 (pfkA_1)
  Energy metabolism
   00680 Methane metabolism
    MMAR_3411 (pfkA_1)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MMAR_3411 (pfkA_1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MMAR_3411 (pfkA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACC41836
UniProt: B2HIS9
Position
complement(4209643..4210776)
Genome map
AA seq 377 aa AA seqDB search
MNSPIKRVAISTGGGDAPGLNAVIHAATLAARNRGWDVVGIRDGLNGLLLPEDYPEGGLI
ELTRDRVRGIIHQGGTIIGTTNRGNPTAYPVRQSDGSWAEVDRTEELLGRFAQHQIDALI
LVGGDGSMSIGQHLHQSGLPLVGVPKTIDNDLDKTTSTFGFDSAVDFASECIDRLFTTAT
SHGRIIVVEVMGRYAGWIALNAGMASGVHAILIPEIPFSLEPVAAVITDREQRGAKFSIV
CVAEGAKPIGGEVTILGKSVGQAERLGGIGAKVAAELERMTGREARTVVLGHLLRGGSPT
SFDRLLGLRFGAAAVRALDEGHYGVMVALNPPTVDYVPLADATHRQKVVPLDCDSILTAR
DMGINFGDEMPTHSTID
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccccgataaagcgagtcgcgatcagcaccggtggcggggacgcgccgggactc
aatgcggtgatccacgcggccactcttgccgcgcgaaaccgcggctgggacgtggtcggg
atccgagacggcctcaatgggctgttgctgcccgaggactatcccgagggcggcctgatc
gagctcacccgcgaccgggttcgcgggatcatccaccagggcggcacgatcatcggcacg
accaatcggggcaacccgaccgcctacccggtgcggcagagcgacggtagctgggccgaa
gtggaccgcaccgaagagctactgggccgattcgcgcagcaccagatcgatgcgctgatc
ctggtgggcggcgacgggtcgatgtcgatcggccagcatctgcaccagtcggggttaccg
ctggtcggcgtacccaagaccatcgacaatgacctggacaagacgacgtccacattcggc
ttcgacagcgcggtcgacttcgcctccgagtgcatcgaccggctcttcaccaccgcgacc
tcccacggccggatcatcgtggtggaggtgatgggccggtacgcgggatggatcgccctg
aacgccggcatggcctcgggggtgcacgcgatcctcatccccgagatcccgttcagtctg
gagccggtggcagctgtgatcaccgatcgcgaacagcgcggcgcgaaattctcgatagtc
tgcgtcgccgagggggccaagccgatcggcggcgaggtcaccatcctgggcaagtcggtg
gggcaggccgaacgcctcggtggcatcggcgccaaggtggccgccgagctggaacgcatg
accggccgcgaagcacgcacggtggtattgggtcacctgctgcggggcggctcgcccacc
tcgttcgaccggctactgggactgcgcttcggcgccgccgccgtgcgggctctcgatgag
gggcactacggcgtcatggtggcgctgaacccgccgacggtggactacgtaccgcttgcc
gacgccacccatcggcagaaggtcgttccgctcgattgcgactcgatcctgaccgcgcgc
gacatggggatcaacttcggcgacgagatgcccacccacagcaccatcgattag

DBGET integrated database retrieval system