KEGG   Mycobacterium sp. MOTT36Y: W7S_07620Help
Entry
W7S_07620         CDS       T02113                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00330  Arginine and proline metabolism
mmm00332  Carbapenem biosynthesis
mmm01100  Metabolic pathways
mmm01130  Biosynthesis of antibiotics
mmm01230  Biosynthesis of amino acids
Module
mmm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    W7S_07620
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    W7S_07620
Enzymes [BR:mmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     W7S_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ACT_7
Motif
Other DBs
NCBI-ProteinID: AFJ34503
UniProt: I2AB29
Position
1608441..1609544
Genome map
AA seq 367 aa AA seqDB search
MTPQRDAIRNARSLVVKVGTNALTTEAGVFDAGRLAGLADAIETRMKAGTDVVIVSSGAI
AAGIEPLGLSRRPRDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLSAHDISMRAQ
HTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGAEALVLLSDIDG
LYDSDPRKTEGAQFIPEVAGSADLVGVIAGPGSDLGTGGMTSKMSSALLAADAGVPVLLA
AADEASTALTDASVGTVFAARPARMSARKFWVRYAAEAAGALTLDEGAVRAVVGQRRSLL
PAGITAVSGRFFGGDVVELRGPDAAMVARGVVAYDATELLTMMGRSTSELPGELRRPAVH
ADDLVAV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgcagcgtgacgccatccggaacgcgcgcagcctggtggtcaaggtgggcacc
aacgcgttgaccaccgaagccggggtattcgacgcgggccggctggccggcctcgccgac
gcgatcgagacgcggatgaaggcgggcaccgacgtcgtcatcgtgtcctcgggtgccatc
gccgccggcatcgaacctctcggattgtcccgtcgcccacgggatttggcgacgaagcag
gccgcggccagcgtcggtcaggtcgcgctggtgaattcgtggagcgccgcgtttgcccgg
tacggacgcacggtcgggcaggtgctgctgagcgcgcacgacatctcgatgcgcgcccag
cacaccaacgctcagcgcacgctggatcggctgcgggcactgcacgcggtggcgatcgtc
aacgaaaacgacacggtggccaccaacgagatccggttcggcgacaacgaccggctctcg
gcgctggtagcccacctggtcggtgccgaggcgctggtgttgttgtccgacatcgacggg
ctgtacgactccgatccgcgcaaaaccgaaggcgcgcagttcatcccggaggtcgcgggt
tcggcggacctggtcggcgtgatcgccgggcccggcagtgacttgggcaccggcggcatg
acgtcaaagatgtcgtcggcgctgctggccgccgacgccggtgtgccggtgctgctggcc
gccgccgacgaggcctcgaccgcactcaccgacgcctccgtcggcacggtgttcgccgcg
cggcccgcgcggatgtcggcgcggaaattctgggtgcggtacgccgcggaggcggccggc
gcgctgaccctcgacgagggcgccgtgcgcgcggtcgtcgggcagcgccgttcgctgctg
cccgcggggatcaccgcggtgtccggccggttcttcggcggcgacgtcgtcgaattgcgc
gggccggacgcggcgatggtggcccgtggcgtggtcgcctacgacgcgacggaactgctc
accatgatgggccgctccaccagcgagctgcccggcgagctgcgcaggcccgccgtgcac
gccgacgacctggtggcggtctaa

DBGET integrated database retrieval system