KEGG   Methylomonas methanica: Metme_4375Help
Entry
Metme_4375        CDS       T01511                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mmt  Methylomonas methanica
Pathway
mmt00010  Glycolysis / Gluconeogenesis
mmt00052  Galactose metabolism
mmt00500  Starch and sucrose metabolism
mmt00520  Amino sugar and nucleotide sugar metabolism
mmt00521  Streptomycin biosynthesis
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
mmt01130  Biosynthesis of antibiotics
mmt01200  Carbon metabolism
Module
mmt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_4375
   00052 Galactose metabolism
    Metme_4375
   00500 Starch and sucrose metabolism
    Metme_4375
   00520 Amino sugar and nucleotide sugar metabolism
    Metme_4375
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metme_4375
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Metme_4375
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Metme_4375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEG02722
JGI: Metme_4375
UniProt: G0A3V0
Position
complement(4803903..4804895)
Genome map
AA seq 330 aa AA seqDB search
MILAGDIGGTKTVLSLLEKEADGLLKCVREQTFASGEYDSFDDILNLFLPANIQLSSVCF
GVAGPVVEQRCFATNLNWTLDAAILKTKLGTEKVRLLNDLEAMAFGMLHLEAEDFVELNP
NAERQSGNIAVIAAGTGLGEAILYWDGRQYHAIASEGGHCSFAPQTVQQDKLLYFLRKQF
PQHVSYERILSGVGFSHLYDFLVDSQFAPPCPAVPSAEYCNGNGADRNAVISRLGINGED
ALCSEAVRMFVEIYGAEAGNLFMKSFATGGVFIGGGIGPKIRSAMQAGGFMMGFTAKGRF
QTLLGKVSVKLALNPRTPLIGAMHYFDTAN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgccggcgatataggcggtactaaaacggttttatctttattggagaaagaa
gcggacggcctgttgaaatgcgtgcgggagcagacgtttgccagcggtgaatatgacagt
tttgatgatattttgaacttgtttttgccggcgaatatacagctaagttcggtgtgtttc
ggcgtggcggggccagtggtcgagcagcgctgttttgccaccaacctgaattggaccctg
gatgcggcgatactgaaaaccaagctgggtaccgaaaaggttagattgcttaacgatctg
gaggccatggccttcggcatgctgcatctggaagccgaggacttcgtcgagcttaaccct
aatgccgagcggcaatccggcaatatcgccgtcatagccgccggtaccggcttaggcgaa
gcgatcttgtattgggatggcaggcagtatcatgccattgccagcgaagggggacactgc
tcgtttgcgccgcaaaccgtacagcaggataaattactgtattttctgcgcaagcaattt
ccgcagcatgtcagttacgaacggattttatccggtgtcggtttcagccatctctatgat
tttctggtcgacagccagtttgccccgccttgtccggcggtgccgagcgcggaatattgc
aatggtaacggtgccgatcgcaacgccgtcatttccaggctgggtattaatggcgaagat
gcgttatgcagtgaggcagtcaggatgtttgtggaaatttacggtgcggaggccggtaat
ctgtttatgaaatcgtttgctaccggaggcgtgtttattggaggcggaatcggtccgaaa
atacgttcagccatgcaggccggcgggtttatgatggggtttactgctaaagggcggttt
caaaccttattgggaaaagtatcggtcaagctggctttaaatcccagaacacccttgatt
ggcgccatgcattacttcgatacggcaaattaa

DBGET integrated database retrieval system