KEGG   Mus musculus (mouse): 14594Help
Entry
14594             CDS       T01002                                 

Gene name
Ggta1, AW108479, GALT, Gal, Ggta, Ggta-1, alpha3GalT
Definition
glycoprotein galactosyltransferase alpha 1, 3 (EC:2.4.1.87)
Orthology
K00743  
N-acetyllactosaminide 3-alpha-galactosyltransferase [EC:2.4.1.87]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    14594 (Ggta1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.87  N-acetyllactosaminide 3-alpha-galactosyltransferase
     14594 (Ggta1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  ABO blood group
   14594 (Ggta1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 B; 2 23.6 cM
AA seq 394 aa AA seqDB search
MITMLQDLHVNKISMSRSKSETSLPSSRSGSQEKIMNVKGKVILLMLIVSTVVVVFWEYV
NRIPEVGENRWQKDWWFPSWFKNGTHSYQEDNVEGRREKGRNGDRIEEPQLWDWFNPKNR
PDVLTVTPWKAPIVWEGTYDTALLEKYYATQKLTVGLTVFAVGKYIEHYLEDFLESADMY
FMVGHRVIFYVMIDDTSRMPVVHLNPLHSLQVFEIRSEKRWQDISMMRMKTIGEHILAHI
QHEVDFLFCMDVDQVFQDNFGVETLGQLVAQLQAWWYKASPEKFTYERRELSAAYIPFGE
GDFYYHAAIFGGTPTHILNLTRECFKGILQDKKHDIEAQWHDESHLNKYFLFNKPTKILS
PEYCWDYQIGLPSDIKSVKVAWQTKEYNLVRNNV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatcactatgcttcaagatctccatgtcaacaagatctccatgtcaagatccaagtca
gaaacaagtcttccatcctcaagatctggatcacaggagaaaataatgaatgtcaaggga
aaagtaatcctgttgatgctgattgtctcaaccgtggttgtcgtgttttgggaatatgtc
aacagaattccagaggttggtgagaacagatggcagaaggactggtggttcccaagctgg
tttaaaaatgggacccacagttatcaagaagacaacgtagaaggacggagagaaaagggt
agaaatggagatcgcattgaagagcctcagctatgggactggttcaatccaaagaaccgc
ccggatgttttgacagtgaccccgtggaaggcgccgattgtgtgggaaggcacttatgac
acagctctgctggaaaagtactacgccacacagaaactcactgtggggctgacagtgttt
gctgtgggaaagtacattgagcattacttagaagactttctggagtctgctgacatgtac
ttcatggttggccatcgggtcatattttacgtcatgatagacgacacctcccggatgcct
gtcgtgcacctgaaccctctacattccttacaagtctttgagatcaggtctgagaagagg
tggcaggatatcagcatgatgcgcatgaagaccattggggagcacatcctggcccacatc
cagcacgaggtcgacttcctcttctgcatggacgtggatcaagtctttcaagacaacttc
ggggtggaaactctgggccagctggtagcacagctccaggcctggtggtacaaggccagt
cccgagaagttcacctatgagaggcgggaactgtcggccgcgtacattccattcggagag
ggggatttttactaccacgcggccatttttggaggaacgcctactcacattctcaacctc
accagggagtgctttaaggggatcctccaggacaagaaacatgacatagaagcccagtgg
catgatgagagccacctcaacaaatacttccttttcaacaaacccactaaaatcctatct
ccagagtattgctgggactatcagataggcctgccttcagatattaaaagtgtcaaggta
gcttggcagacaaaagagtataatttggttagaaataatgtctga

DBGET integrated database retrieval system