KEGG   Mus musculus (mouse): 100042807Help
Entry
100042807         CDS       T01002                                 

Gene name
Eif3j2, Eif3j-2, Gm9781, eIF3_p35, eIF3j-B
Definition
eukaryotic translation initiation factor 3, subunit J2
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100042807 (Eif3j2)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100042807 (Eif3j2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 B3; 18
AA seq 263 aa AA seqDB search
MAAAAAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDD
DDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLA
DKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLY
YASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKAT
MKDDLADYGGYEGGYVQDYEDFM
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcggcagcggcggcgggggactcagactcttgggac
gcggacacgttctctatggaggacccggtgcggaaggtcgcgggcggcggcacggccggc
ggggaccgctgggaaggcgaggacgaggacgaggacgtgaaggataactgggatgatgat
gatgatgaaaataaagaggaagcagaagtcaaaccagaagtaaaaatttcagagaagaaa
aaaatagcagaaaagataaaagagaaagaacggcagcagaagaaaaggcaagaagaaatt
aaaaagaggttagaagaacctgaagaatctaaagtactaacacctgaagagcaattagca
gataaactccggctaaagaaattacaggaagagtcagaccttgaattagcaaaagaaact
tttggtgttaataataccgtttatggaatagatgctatgaacccatcttcaagagatgac
ttcacagagtttggaaagttactaaaagataaaattacacaatatgaaaaatcactatat
tatgccagttttttggaagccttagttcgggatgtctgtatttcattggaaattgatgac
ttgaaaaagattaccaactcattgactgtgctctgcagtgaaaaacagaagcaagaaaag
caaagcaaagccaaaaagaagaagaaaggcgtggttcctggagggggattaaaggccacc
atgaaagacgacctggcagattatggtggatatgaaggaggctatgtacaagactatgaa
gacttcatgtga

DBGET integrated database retrieval system