KEGG   Mus musculus (mouse): 107747Help
Entry
107747            CDS       T01002                                 

Gene name
Aldh1l1, 1810048F20Rik, FDH, Fthfd, Neut2
Definition
aldehyde dehydrogenase 1 family, member L1 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    107747 (Aldh1l1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     107747 (Aldh1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 D1; 6
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPLGLEAEKDGVPVFKFPRWR
ARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECDVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGTAPRRPQPEEGATYEGIQKKETAMINWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTSGLVAQGEALPIPGAHRPGLVTKAGLILFGNDDRMLLVKNIQLEDGKMM
PASQFFKGSASSALELTEEELATAEAVRSSWMRILPNVPEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGEDGESECVINYVEKAVKKLTLQM
PYQLFIGGEFVDAEGAKTYSTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFENGLWGKI
NARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DQFVQKVVEEVGKMKIGNPLDRDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVP
RPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagtaatcgggcagagcctgtttggccaggaggtttactgccagctaagg
aaggagggccatgaggtggtgggtgtgttcaccatcccagacaaggatgggaaagcagat
cccctgggcctggaggccgagaaggatggcgtgcccgtgtttaagttccctcggtggcgg
gctcgaggacaggctctgcccgaggtcgtggccaagtaccaggctctgggtgcagaactc
aacgtgctccccttctgcagccagttcatacccatggaggtcatcaatgccccccggcat
ggctccatcatctaccatccatctctgctgcccaggcaccgaggggcctcagccatcaac
tggaccctcattcatggagataagaaaggaggcttcactatcttctgggctgatgacggt
ctggacactggtgaccttctgctgcagaaggagtgtgacgtgcttccagatgacaccgtg
agcacgctgtacaaccgtttcctcttcccagagggcatcaaagggatggttcaggctgtg
cgactgattgcagagggcacagccccacgccgtccccagcctgaggaaggagccacctat
gagggcattcagaaaaaggagacagccatgatcaactgggaccagccagcagaggccatt
cacaactggatccgtgggaatgacaaggtgccaggtgcctggacagaggcttgtgggcag
aagctgacgtttttcaactcgacactcaacacttcaggactggtggctcagggagaagct
ctacccatcccaggagcccatcgtccaggcctagtcaccaaagcgggactcatcctcttt
gggaatgatgatagaatgttgctggtgaagaatatccagctggaagatggcaagatgatg
ccagcctcccagttcttcaaggggtctgctagcagtgccctggagctgaccgaggaggag
ctggccacagcagaggccgtgcggagctcttggatgcgaattctgcccaatgtcccagag
gtagaagactctacagatttcttcaagtcaggagctgcatccgtagatgttgtgaggctg
gtggaggaggtgaaggagctgtgtgacgggctggagttagaaaatgaggatgtttacatg
gccaccaccttcggggacttcatccagctcctagtgaggaagttgagaggggaggacggc
gagagcgagtgtgtcattaactacgtggaaaaggcagtgaagaaactgactctccaaatg
ccctaccagctcttcataggcggcgagtttgtggatgctgagggcgcgaagacctacagt
accataaacccaacggatggaagtgtcatctgccaggtgtctctagctcaggtgagtgat
gttgacaaggcggtggcagcagcgaaggaggcctttgagaatggactgtggggaaagata
aatgcgcgtgaccggggccggctcctgtacaggttggcggacctcatggagcagcaccag
gaagagctagccaccattgaggccctggacgcaggtgccgtctacacgctggccctgaag
acgcatgtgggcatgtccatccagaccttccgatacttcgctggctggtgtgataagatc
cagggtgccaccatccccatcaaccaggctagacccaaccgcaacctgaccttgaccaag
aaggaacctgttggggtctgtggtattgtcatcccctggaactatcccttaatgatgctg
tcctggaagacagcagcctgcctggctgccgggaacaccgtggtgatcaagcctgcccag
gtgaccccactcacagccttgaagtttgcagagctgacactgaaggctggcattcccaag
ggtgtggtcaacatcctcccaggatctggctcgctggttggccagagactctcagaccac
cctgatgtgaggaaaatagggttcacaggctccacggaggtgggaaaacacatcatgaaa
agctgtgccctgagtaatgtgaagaaggtctccctggagctgggtggaaagtcacccctt
atcatctttgctgactgtgacctcaacaaagctgtgcagatgggcatgagctccgttttc
ttcaacaaaggggagaactgcattgcggcaggccggctctttgtggaggactccatccat
gaccagtttgtgcagaaagtggtggaggaagtagggaagatgaaaatcggcaaccccctg
gacagagataccaaccatggcccgcagaaccatgaggcccacctgaggaagctggtggag
tattgccaacgtggtgtgaaggaaggggccacactggtctgtggtgggaaccaagtccca
aggccaggcttcttctttcagccaaccgttttcacagacgtggaggaccacatgtacatc
gctaaggaggagtccttcgggcccatcatgatcatctctcggtttgctgatggggacgtg
gatgcagtgctatctcgggccaatgctacagaatttggcctggcctctggtgtcttcact
cgggatatcaacaaggccctgtatgtcagtgacaaactgcaggcgggcactgtgtttgtc
aacacatacaacaagaccgatgtggccgcaccttttggaggattcaagcagtctggattt
ggcaaagacctgggagaggcggccctgaatgagtacctgcggatcaagactgtgactttt
gagtactga

DBGET integrated database retrieval system