KEGG   Mus musculus (mouse): 108058Help
Entry
108058            CDS       T01002                                 

Gene name
Camk2d, 2810011D23Rik, 8030469K03Rik, CaMK_II, [d]-CaMKII
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II, delta
  KO
K04515  
calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Calcium signaling pathway
cAMP signaling pathway
HIF-1 signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Wnt signaling pathway
Axon guidance
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Oxytocin signaling pathway
Glucagon signaling pathway
Aldosterone synthesis and secretion
Gastric acid secretion
Amphetamine addiction
Tuberculosis
Proteoglycans in cancer
Glioma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    108058 (Camk2d)
   04310 Wnt signaling pathway
    108058 (Camk2d)
   04066 HIF-1 signaling pathway
    108058 (Camk2d)
   04020 Calcium signaling pathway
    108058 (Camk2d)
   04024 cAMP signaling pathway
    108058 (Camk2d)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    108058 (Camk2d)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    108058 (Camk2d)
   04922 Glucagon signaling pathway
    108058 (Camk2d)
   04912 GnRH signaling pathway
    108058 (Camk2d)
   04921 Oxytocin signaling pathway
    108058 (Camk2d)
   04916 Melanogenesis
    108058 (Camk2d)
   04925 Aldosterone synthesis and secretion
    108058 (Camk2d)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108058 (Camk2d)
  Digestive system
   04971 Gastric acid secretion
    108058 (Camk2d)
  Nervous system
   04725 Cholinergic synapse
    108058 (Camk2d)
   04728 Dopaminergic synapse
    108058 (Camk2d)
   04720 Long-term potentiation
    108058 (Camk2d)
   04722 Neurotrophin signaling pathway
    108058 (Camk2d)
  Sensory system
   04740 Olfactory transduction
    108058 (Camk2d)
   04750 Inflammatory mediator regulation of TRP channels
    108058 (Camk2d)
  Development
   04360 Axon guidance
    108058 (Camk2d)
  Environmental adaptation
   04713 Circadian entrainment
    108058 (Camk2d)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    108058 (Camk2d)
   05214 Glioma
    108058 (Camk2d)
  Substance dependence
   05031 Amphetamine addiction
    108058 (Camk2d)
  Infectious diseases
   05152 Tuberculosis
    108058 (Camk2d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108058 (Camk2d)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CAMK2 family
   108058 (Camk2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 G1-G2
AA seq 499 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccaccacctgcacccggttcaccgacgagtatcagctctttgaggagctc
ggaaagggggcgttctcagtggtgagaagatgtatgaaaatccctactggacaagagtat
gctgccaaaattatcaacaccaaaaagctttctgctagggaccatcagaaactggaaagg
gaagctagaatctgccgtctcttgaagcaccccaatattgtgagacttcacgacagtata
tcggaggagggcttccattacttggtgtttgacttagtgactggtggcgaactgtttgaa
gacatagtggcaagagaatattacagtgaagctgatgccagtcattgtatacaacagatt
ctagagagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaagtccaaaggagcagctgtgaagctggcagacttcggctta
gccatagaagttcaaggcgaccagcaggcatggtttggttttgctggcacacctgggtat
ctttctccagaagtcctgcgtaaagatccttatggaaaaccagtggatatgtgggcatgc
ggtgtcatcctctacatcttgctggtgggatacccacccttctgggatgaagatcagcat
agactgtatcagcagatcaaggccggagcttacgattttccgtcaccagaatgggataca
gtgacacctgaagccaaagacctcatcaacaaaatgctgaccatcaaccctgccaaacgt
atcacagcctctgaggccctgaaacacccatggatctgtcaacgctctactgttgcctcc
atgatgcacaggcaggagactgtagactgcttgaagaaatttaatgctagacggaaactg
aagggcgccatcttgacaactatgctggctacgagaaatttttcagcagccaagagttta
ttgaagaaaccagatggggtaaaggagtcaactgagagctcaaacaccaccattgaggat
gaagacgtgaaagcacgaaaacaggagatcatcaaagtcactgagcaactgattgaagct
atcaacaatggggactttgaggcttacacaaaaatctgtgatccaggcctcactgccttt
gaacctgaagcattgggcaacttagtggaagggatggactttcacagattctactttgaa
aatgctttgtccaaaagcaataaaccaatccacacgatcatcctcaacccacacgttcac
ctggtaggggatgacgcagcctgcatcgcatacattcggctcacacagtacatggacgga
agcgggatgccaaagaccatgcagtcagaagagacgcgcgtgtggcaccgccgtgatggg
aagtggcagaatgttcactttcaccgttcggggtcccccacagtacccatcaagccaccc
tgtattccaaatgggaaagagaacttctcaggaggcacctctttgtggcaaaacatctga

DBGET integrated database retrieval system