KEGG   Mus musculus (mouse): 109820Help
Entry
109820            CDS       T01002                                 

Gene name
Pgc, 2210410L06Rik, Upg-1, Upg1
Definition
(RefSeq) progastricsin (pepsinogen C)
  KO
K01377  
gastricsin [EC:3.4.23.3]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.3  gastricsin
     109820 (Pgc)
Peptidases [BR:mmu01002]
 Aspartic Peptidases
  Family A1: pepsin family
   109820 (Pgc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 C; 17 23.98 cM
AA seq 392 aa AA seqDB search
MKWMVVALLCLPLLEAALIRVPLKKMKSIRETMKEQGVLKDFLKNHKYDPGQKYHFGKFG
DYSVLYEPMAYMDASYYGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQSEACTTHTRYNP
SKSSTYYTQGQTFSLQYGTGSLTGFFGYDTLRVQSIQVPNQEFGLSENEPGTNFVYAQFD
GIMGLAYPGLSSGGATTALQGMLGEGALSQPLFGVYLGSQQGSNGGQIVFGGVDENLYTG
ELTWIPVTQELYWQITIDDFLIGNQASGWCSSSGCQGIVDTGTSLLVMPAQYLNELLQTI
GAQEGEYGQYFVSCDSVSSLPTLTFVLNGVQFPLSPSSYIIQEEGSCMVGLESLSLNAES
GQPLWILGDVFLRSYYAVFDMGNNRVGLAPSV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggatggtggtcgccttgctctgcctcccactcctggaggcagctttgatcagg
gtccccctgaagaaaatgaagagtatccgggagaccatgaaggaacaaggtgtcctcaaa
gactttctgaagaaccacaagtatgaccctggccagaaataccactttggcaagtttggt
gactacagtgtactctatgagcccatggcctatatggatgcttcctactatggtgagatc
agcatcgggactccaccccagaacttcctggtccttttcgacactggctcctccaacctg
tgggtgtcttctgtctactgccagagcgaggcctgcaccacacacacccgctacaacccc
agcaagtcctccacctactacactcaagggcagaccttctccctgcagtacggcaccggc
agccttaccggcttcttcggctatgacactctgagagtccaaagcatccaggtccctaac
caggagttcggcctgagtgagaatgagcctggcaccaattttgtctacgcccaatttgac
gggatcatgggcctggcctaccccggcctgtcttcagggggcgccaccaccgccttgcag
ggcatgttgggggagggcgctctgtcccagcccctcttcggtgtctaccttggcagccag
caggggtctaacggcgggcagattgtgttcggtggcgtggacgagaacctgtacactggc
gagctcacctggattcctgtcacccaggagctttactggcagatcaccattgacgacttc
cttattggcaaccaggcctctggctggtgctcctcctctggctgccaaggcattgtagac
acaggcacctctctgctcgtcatgcctgcccagtacctgaatgaacttctgcagaccata
ggagcccaggaaggagagtatggacagtattttgtgagctgcgacagcgtcagtagcctg
cctaccctcacttttgtcctcaatggtgtccagttccccctgtcaccctcttcctacatc
atccaggaggaaggctcctgcatggtgggtctggagagcctctccctgaacgctgagagt
ggccagcccctctggatcctcggggatgtcttcctcaggtcttactatgctgtcttcgac
atgggcaataacagggtgggccttgccccttctgtctag

DBGET integrated database retrieval system