KEGG   Mus musculus (mouse): 11303Help
Entry
11303             CDS       T01002                                 

Gene name
Abca1, ABC-1, Abc1
Definition
(RefSeq) ATP-binding cassette, sub-family A (ABC1), member 1
  KO
K05641  
ATP-binding cassette, subfamily A (ABC1), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
ABC transporters
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    11303 (Abca1)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    11303 (Abca1)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    11303 (Abca1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 28.57 cM; 4 A5-B3
AA seq 2261 aa AA seqDB search
MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKA
MPSAGTLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVSRLFSDAQRLLLYSQRDT
SIKDMHKVLRMLRQIKHPNSNLKLQDFLVDNETFSGFLQHNLSLPRSTVDSLLQANVGLQ
KVFLQGYQLHLASLCNGSKLEEIIQLGDAEVSALCGLPRKKLDAAERVLRYNMDILKPVV
TKLNSTSHLPTQHLAEATTVLLDSLGGLAQELFSTKSWSDMRQEVMFLTNVNSSSSSTQI
YQAVSRIVCGHPEGGGLKIKSLNWYEDNNYKALFGGNNTEEDVDTFYDNSTTPYCNDLMK
NLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELS
PQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNGS
VYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEVRLINKSMELLDERKFWAGIVFTG
ITPDSVELPHHVKYKIRMDIDNVERTNKIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVV
EQAIIRVLTGSEKKTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIV
YEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFV
FLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFAS
LLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTW
YIEAVFPGQYGIPRPWYFPCTKSYWFGEEIDEKSHPGSSQKGVSEICMEEEPTHLRLGVS
IQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIL
GKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVG
LPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ
GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLS
SCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDI
GHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAE
TSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
GWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQ
PWMYNEQYTFVSNDAPEDMGTQELLNALTKDPGFGTRCMEGNPIPDTPCLAGEEDWTISP
VPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQRKQKTADILQNL
TGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDAIKQMKK
LLKLTKDSSADRFLSSLGRFMAGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQK
GENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQER
VSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLAL
LLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFTNNKLNDIN
DILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEG
VVFFLITVLIQYRFFIRPRPVKAKLPPLNDEDEDVRRERQRILDGGGQNDILEIKELTKI
YRRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSN
IHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEK
YASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRSVVLT
SHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFG
LAFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNF
AKDQSDDDHLKDLSLHKNQTVVDVAVLTSFLQDEKVKESYV
NT seq 6786 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttggcctcagttaaggctgctgctgtggaagaatctgacatttcgaaggaga
caaacatgtcagctgttactggaagtggcctggcctctctttatcttcctgatcctgatc
tctgtacgcctgagctacccaccctacgaacaacatgagtgccactttccgaataaagcc
atgccgtctgcaggaaccctcccctgggtacaggggattatctgtaatgccaacaacccc
tgcttccgttatccaactcccggcgaggctcccggtgttgttggaaactttaacaagtcc
atcgtgtctcgcctgttctcagacgctcagaggcttcttctgtacagccaaagagatacc
agcattaaggacatgcacaaggtcctgagaatgttacggcagatcaagcatcccaactca
aatttgaagctccaggattttctggtggacaatgaaacattctctggattcctgcagcac
aatttgtcccttccaagatctactgtggacagcctgctgcaggcgaatgttggtctccag
aaggtatttttgcaaggctaccaattacatttggccagtctgtgtaacggatcaaaatta
gaagaaattattcagcttggtgatgcggaagtttctgccctctgtggtctaccgaggaag
aagctcgatgcagccgagagagtactgcgctacaacatggacatcctgaagccagttgtg
acaaaactaaattccacatctcatctcccgacccagcatctggctgaagccaccacagtg
ttgcttgacagcttggggggcctggcccaagagctgttcagcacaaagagctggagcgac
atgcggcaggaggtgatgtttctgaccaacgtgaacagctccagctcctccacccagatc
taccaggcagtgtcccgcatcgtgtgtggtcacccagagggtgggggcctgaagatcaag
tccctcaactggtacgaggataacaactacaaagccctctttggagggaataacaccgag
gaagacgtggacaccttctatgacaattctacaactccttattgcaatgatttgatgaag
aacttggagtctagtcctctttctcgaattatttggaaggcactcaagccactgcttgtt
ggaaagattctctatacacctgacacaccagctacaaggcaggtcatggctgaggtgaac
aagacctttcaggagttggctgtgttccatgacctggagggcatgtgggaagaactcagc
ccccaaatttggaccttcatggagaacagccaagagatggaccttgtccggacgctgtta
gacagcagaggcaatgaccagttttgggaacagaagttggatggattagattggactgcc
caagacatcatggcgtttctggccaagaacccagaagatgttcagtccccaaatggctct
gtgtatacctggagagaagctttcaatgagaccaaccaggcaatccagacgatatctcga
ttcatggagtgtgtcaacctgaacaagctggaacccattccgacagaagtcaggctcatc
aacaagtccatggagctgctggacgagaggaagttctgggctggcatcgtgttcacaggc
atcactccagatagtgtggagctgccccatcatgtaaagtacaagatccggatggacatt
gacaacgtggagagaactaataagatcaaggatgggtactgggaccctggtcctcgggct
gacccttttgaagatatgcgctatgtctggggcggcttcgcctacttgcaggatgtggtg
gaacaggccatcatcagagtgctgacgggatctgagaagaaaacgggtgtctacgtgcaa
cagatgccctacccctgttatgttgatgacatttttctgcgggtcatgagccggtcaatg
cccctcttcatgactctagcctggatctactctgtcgctgtgatcatcaagagcattgtg
tatgagaaggaggctcggctgaaggagaccatgcggatcatgggtctggacaatggcatc
ctctggtttagctggtttgttagcagcctcatccctctgcttgtgagcgctggcctgctg
gtggtcatcttgaagttaggaaacctgctgccctatagtgaccccagcgtggtgttcgtc
ttcctgtctgtgtttgccatggtgaccatcctacagtgcttcctcattagcacgctcttc
tcccgtgccaacctggcagcagcctgtgggggcatcatctacttcacgctgtacctgccc
tatgtgctgtgcgtagcctggcaggactatgtgggcttctccatcaagatctttgctagc
ctgctgtctcctgtggcttttggattcggctgtgagtatttcgcccttttcgaggagcaa
ggtatcggggtccaatgggacaatctctttgagagcccggtggaggaggacggcttcaat
ctcaccactgcagtgtccatgatgctctttgacacctttctctatggcgtgatgacatgg
tacatcgaagccgtctttccaggacagtatggaattcccaggccctggtattttccttgt
accaagtcatactggtttggtgaggaaattgatgagaagagccaccctggttccagccag
aagggagtgtcagaaatctgcatggaagaggaacccactcatctgaggctgggggtgtcc
attcagaacctggtgaaggtttaccgagatggcatgaaggttgctgtggatggcttggcg
ctcaacttttacgaaggccagattacctccttcctgggccacaatggagcagggaagacc
accaccatgtcaatactgactgggctgtttcccccaacttctggcacggcctacatcctg
gggaaggacattcgctcggagatgagctccatccggcagaacctgggagtctgtccccag
cataatgtgctgtttgacatgctgactgtcgaagagcacatctggttctatgcgcgccta
aaggggctctcagagaagcacgtgaaagcagagatggagcagatggccctggatgttggc
ttacccccgagcaagctgaaaagcaaaacgagtcagctctcaggtgggatgcagagaaag
ctgtctgtggccttggccttcgtgggtggatccaaggttgtcattctggacgagcccaca
gccggggtggacccgtactctcgcaggggaatatgggaactcctgctaaaataccggcaa
ggccgcaccattattttgtctacacaccacatggacgaagctgacatccttggggacaga
attgccatcatttcccatgggaagctgtgttgtgtgggctcctccctgtttttgaaaaac
cagttgggaacgggttactatctgaccctggttaagaaagatgtggaatcgtccctcagt
tcctgcagaaacagtagcagcaccgtgtcttgtctgaaaaaggaggacagtgtttctcag
agcagttctgatgctggcctgggcagcgaccatgaaagtgacacgctgaccatcgatgtc
tctgctatctccaacctcatcaggaagcacgtgtctgaagcccggctggtggaggacatt
gggcacgagctgacctatgtgctgccgtacgaagccgcgaaggagggagcctttgtggaa
ctcttccatgagattgatgaccggctctcagacctgggcatctccagttatggcatctcg
gagaccaccctggaagaaatattcctcaaagtggctgaagagagcggggtggatgctgag
acctcagatggtactttgccagcaagacgaaacagacgggccttcggggacaagcagagc
tgtctgcacccatttacggaagatgatgctgttgatcccaatgactctgacatagaccca
gaatccagggagaccgacctgctcagtgggatggacggcaaaggctcctaccagctgaag
ggctggaaactcacccagcaacagtttgtggcccttttgtggaagaggctgctgattgcc
agacggagccggaagggtttctttgctcagattgtcctgccagctgtctttgtttgcatt
gccctggtcttcagcctgattgtgccaccctttggcaagtaccccagcctggaacttcag
ccctggatgtataatgagcagtatacatttgtcagtaatgatgctcccgaggacatgggc
acccaggaactcctgaatgctctgaccaaagatccaggctttgggacccgctgtatggaa
ggaaacccaatcccagataccccttgcttggctggggaggaggactggaccatcagcccc
gtcccccagagcatcgtggacctcttccagaatggaaactggaccatgaagaacccctca
cctgcgtgccagtgtagcagtgacaaaatcaagaagatgctgcctgtgtgtcccccaggg
gcaggggggctgccacctcctcagagaaaacagaaaaccgcagacatccttcagaatctg
acaggaagaaatatttcagattacctggtgaagacgtacgtgcagatcatagcaaagagc
ttaaagaataagatctgggtgaacgagtttcggtatggcgggttttccctgggtgtcagt
aattctcaagcacttcctccgagccatgaagttaatgatgctatcaagcaaatgaagaaa
ctcctgaagctgaccaaggacagctccgcagatcgcttcctcagcagcctgggaaggttc
atggcagggctggatacgaaaaacaatgtcaaggtgtggttcaataacaagggctggcat
gctatcagttcgttcctgaatgtcatcaacaatgccattctccgggccaacctgcagaag
ggagagaacccgagccagtatggaatcactgctttcaaccaccccttgaacctcactaaa
cagcagctctcagaggtggctctgatgaccacctctgtcgacgtcctcgtgtctatctgt
gtcatctttgcgatgtcctttgtccctgccagctttgttgtgttcctgatccaggagcgt
gtgagcaaagccaagcatcttcagttcatcagcggcgtgaagcctgtcatctactggctg
tccaattttgtctgggatatgtgcaattatgtggtccctgctacactggtcattatcatc
ttcatctgcttccagcagaagtcctatgtgtcctctaccaacctgcccgttctagccctt
ctgctcttgctgtatgggtggtcgatcactcctctcatgtatccagcatcctttgtgttc
aagatccccagcaccgcctatgtggttctcaccagtgtgaacctcttcatcggcatcaat
ggcagtgtggccactttcgtactggagctgtttacaaacaataagctcaatgacatcaat
gacatcctgaagtctgtgtttcttatcttcccacatttttgcctggggcgagggctcatc
gacatggtgaagaaccaggccatggccgatgccctggagaggtttggggagaaccgcttc
gtctctccgctctcttgggacttggtaggacggaacctttttgccatggccgtggaaggg
gtggtgttcttcctcattactgttctgatccagtacagatttttcatcaggcccagacct
gtaaaggcgaagcttcctcctttgaatgacgaggatgaggatgtgaggcgggagagacag
aggattctggacggtggcggacagaatgacatcctagagatcaaggaactgaccaagatc
tataggaggaagcggaagcctgcagtcgacaggatctgcatcggcatccctcccggagag
tgctttggactcctgggagttaacggagctgggaagtcaacaactttcaagatgctgact
ggagacacccctgtgaccagaggggatgcgttccttaacaaaaacagcatcttatcaaat
atccatgaagtacaccagaacatgggctactgccctcagtttgacgccatcacagagctg
ctgacgggaagagagcatgtggagttctttgccctcctgaggggagtcccagaaaaggaa
gttggcaaggttggtgaatgggcaattcgcaaactgggcctggtaaagtatggagaaaaa
tatgccagtaactacagtggcggcaacaaacgaaagctctccacagccatggctttgatt
ggcggacctcctgtggtgtttctggatgaaccaaccacaggcatggaccctaaagcccgg
agattcttgtggaattgtgccctaagcattgtcaaggaggggagatctgtagtccttaca
tctcatagtatggaagaatgtgaagctctttgtacaaggatggccataatggtcaatgga
aggttcaggtgccttggcagtgtccaacatctgaaaaacaggtttggagatggttataca
atagttgtacgaatagcaggctccaaccctgacctgaagcctgtccaggagttctttgga
cttgcgtttccgggaagtgtcctaaaagagaaacatcgaaacatgcttcagtaccagctt
ccatcctccttgtcatctctagccaggatattcagcatcctctcccagagcaaaaagcga
ctccacatagaagactactctgtctctcagacaacacttgaccaagtatttgtgaacttt
gccaaggaccaaagtgatgatgaccacttaaaggacctgtcactgcacaaaaaccagaca
gttgtggatgtggccgttctcacatcctttttgcaggatgagaaagtgaaagaaagttat
gtatga

DBGET integrated database retrieval system