KEGG   Mus musculus (mouse): 114875Help
Entry
114875            CDS       T01002                                 

Gene name
Plcz1, 1700041H07Rik, PLCzeta
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114875 (Plcz1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    114875 (Plcz1)
   04070 Phosphatidylinositol signaling system
    114875 (Plcz1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    114875 (Plcz1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    114875 (Plcz1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     114875 (Plcz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 G1
AA seq 647 aa AA seqDB search
MESQLHELAEARWFLSKVQDDFRGGKINVEITHKLLEKLDFPCHFAHVKHIFKENDRQNQ
GRITIEEFRAIYRCIVHREEITEIFNTYTENRKILSENSLIEFLTQEQYEMEIDHSDSVE
IINKYEPIEEVKGERQMSIEGFARYMFSSECLLFKENCKTVYQDMNHPLSDYFISSSHNT
YLISDQILGPSDIWGYVSALVKGCRCLEIDCWDGSQNEPIVYHGYTFTSKLLFKTVVQAI
NKYAFVTSDYPVVLSLENHCSPGQQEVMASILQSTFGDFLLSDMLEEFPDTLPSPEALKF
KILVKNRKVGTLSETHERIGTDKSGQVLEWKEVIYEDGDEDSGMDPETWDVFLSRIKEER
EADPSTLSGIAGVKKRKRKMKIAMALSDLVIYTKAEKFRNFQYSRVYQQFNETNSIGESR
ARKLSKLRVHEFIFHTAAFITRVYPKMMRADSSNFNPQEFWNVGCQMVALNFQTPGLPMD
LQNGKFLDNGGSGYILKPDILRDTTLGFNPNEPEYDDHPVTLTIRIISGIQLPVSSSSNT
PDIVVIIEVYGVPNDHVKQQTRVVKNNAFSPKWNETFTFLIQVPELALIRFVVETQQGLL
SGNELLGQYTLPVLCMNKGYRRVPLFSKSGANLEPSSLFIYVWYFRE
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggaaagccaacttcatgagctcgcagaagcaagatggtttttgtcaaaggttcaggat
gattttagaggtggaaaaatcaacgttgaaattactcacaaactgcttgagaaacttgat
ttcccatgccactttgctcatgtgaaacatatttttaaggaaaatgacagacagaaccaa
ggaagaatcaccattgaagagtttagagccatttaccggtgtattgtacatagagaagaa
atcacggagattttcaacacgtatactgaaaataggaaaattctttctgagaacagtctg
attgagtttctaacccaagagcagtatgaaatggagatcgatcactctgattcagtagag
atcatcaataagtatgagcccattgaagaagtaaagggtgagcgacagatgtcaattgaa
ggtttcgcaagatacatgttttcatcagaatgtctactgtttaaagagaactgtaaaacc
gtgtaccaagatatgaatcatccattaagtgattattttatttcatcatctcacaacaca
tatttgatatccgatcaaatattgggaccgagtgacatttggggatatgtaagtgctctt
gtgaaaggctgccgctgtctggaaattgactgctgggatggatcccaaaatgaacccatt
gtgtaccatggttacacattcaccagcaagcttctcttcaaaactgtggtccaagcaata
aacaagtatgcctttgtgacatctgattacccagtagtgctgtccttagaaaatcactgc
tcccctggtcagcaggaagtgatggctagcattctgcagagcacctttggagacttcctg
ctttcggacatgcttgaggagtttccagatacactaccgtctccagaggcactaaaattc
aaaatattagtgaaaaacaggaaagtgggaaccttatctgaaacccacgagaggatagga
accgacaaaagtggccaagtgctagaatggaaagaagtcatctatgaagatggtgatgaa
gactcaggaatggatccagaaacatgggatgtcttcctatcacggatcaaggaggagagg
gaagcagatccctcgacattgagtggaatagcaggcgtcaagaaaaggaagaggaagatg
aaaatagccatggccttatctgatcttgtcatttatactaaggctgagaagttccgaaac
ttccaatattcaagagtctatcagcaatttaatgagaccaattcgattggagagtctcga
gctcgaaaactttccaaattgagagtccatgagtttattttccacaccgcggcattcatc
accagagtataccccaaaatgatgagagcagactcttctaactttaaccctcaagagttt
tggaatgtaggatgtcagatggtggccttgaactttcaaacccctggactgcctatggat
ttgcaaaacgggaaatttttggataatggaggctctggatatattttgaagccagacatc
cttagagatacaaccctgggctttaacccaaatgaaccagaatatgacgaccatccagtt
accctcacaatccgaatcatcagtgggatccagttgcctgttagctcatcctctaacacg
cctgacatagtagtgatcatagaagtctacggtgttccaaacgaccacgtgaagcagcag
actcgtgttgttaagaataatgcttttagtccaaagtggaatgaaacatttacatttctt
attcaagtgccagaactggcattgatacgttttgttgttgaaactcaacaaggcttatta
tcaggaaatgaattactcgggcagtacactttaccagttctttgcatgaacaaaggttat
cgtcgtgttcctctgttttccaaatccggtgcgaaccttgaaccttcctcactgtttatt
tatgtttggtacttcagagagtga

DBGET integrated database retrieval system