KEGG   Mus musculus (mouse): 11546Help
Entry
11546             CDS       T01002                                 

Gene name
Parp2, ARTD2, Adprt2, Adprtl2, Aspartl2, C78626, PARP-2
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 2 (EC:2.4.2.30)
  KO
K10798  
poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Base excision repair
Apoptosis
Module
BER complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    11546 (Parp2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    11546 (Parp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     11546 (Parp2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    11546 (Parp2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    11546 (Parp2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     11546 (Parp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 26.25 cM; 14 C1
AA seq 559 aa AA seqDB search
MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNR
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcggcggcagagatcaggctctggaaggcgagtgctaaatgaagccaagaaa
gttgataatggcaacaaagcaacagaagacgactctcctcctggcaagaagatgcgcacg
tgccagagaaaagggcctatggctggagggaaggacgcagacaggacaaaagacaatcga
gactctgtgaagaccttgctgttaaagggcaaagcccctgtggacccagagtgtgcagcc
aagctgggaaaggctcatgtgtattgtgaaggagatgatgtctatgatgtcatgctaaat
caaaccaatctccagttcaacaacaacaagtactaccttattcagctgttagaagatgat
gcccagaggaacttcagtgtttggatgaggtggggccgagttggaaagacggggcagcac
agcttggtgacttgttctggtgacctcaacaaagcaaaagaaatatttcagaaaaaattc
cttgacaaaactaaaaacaattgggaggaccgtgagaactttgaaaaagtacctggaaaa
tacgacatgttacagatggactatgctgccagcacgcaggatgaaagtaaaacaaaagaa
gaggaaactttgaagcctgagtctcagctggatcttcgagtccaggagctgctaaagttg
atctgtaacgtgcagaccatggaagaaatgatgattgagatgaagtatgacaccaagaga
gccccgcttggaaagctgacagtggcgcaaatcaaggccggttaccagtctctcaagaag
attgaggactgcatccgcgctggccagcatgggcgagcgcttgttgaagcgtgcaatgaa
ttctacaccaggatccctcatgactttggactctccatccctccagtaatccggacagag
aaggaactgtcagacaaagtaaaactgctagaggcattgggagacattgaaattgccctt
aaactggtgaagtcagagcgccaaggcctagaacacccactggaccaacactatagaaac
ctacactgtgctttgcgtcctctggaccatgaaagtaatgagtttaaggtgatttctcag
tacctacagtctacgcatgctcctacacacaaggactatactatgaccttgctggatgtt
ttcgaagtagagaaggaaggggagaaagaggccttcagggaggaccttcctaacaggatg
ctgctctggcatggatccaggctgagtaactgggtggggatcctgagccacgggcttaga
gttgccccacctgaggctcccatcacaggttatatgtttggaaaaggaatctactttgct
gacatgtcctccaagagtgccaattactgctttgcctctcgcctaaagaatacaggattg
cttcttctgtcagaggtagctctaggtcagtgtaatgaactactggaggccaatcctaaa
gcacaaggattgcttcggggcaagcatagcaccaaggggatgggaaagatggctcccagc
cctgcccacttcatcaccctgaatgggagtacagtgcccttaggaccagcaagtgacaca
ggaattctcaatccagaggggtacaccctcaactacaatgagtttattgtttatagcccc
aaccaggtccgtatgcgataccttctaaagattcaatttaacttcctgcagctatggtga

DBGET integrated database retrieval system