KEGG   Mus musculus (mouse): 12488Help
Entry
12488             CDS       T01002                                 

Gene name
Cd2ap, AL024079, C78928, METS-1, Mets1
Definition
(RefSeq) CD2-associated protein
  KO
K13738  
CD2-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    12488 (Cd2ap)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    12488 (Cd2ap)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12488 (Cd2ap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
17; 17 B3
AA seq 637 aa AA seqDB search
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TEPKDDNLPIKRERQGNVASLVQRISTYGLPAGGIQPHPQTKAIKKKTKKRQCKVLFDYS
PQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKELESTEDGETHNAQEES
EVPLTGPTSPLPSPGNGSEPAPGSVAQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKK
TEKPLILQPLGSRTQNVEVTKPDVDGKIKAKEYCRTLFPYTGTNEDELTFREGEIIHLIS
KETGEAGWWKGELNGKEGVFPDNFAVQISELDKDFPKPKKPPPPAKGPAPKPDLSAAEKK
AFPLKAEEKDEKSLLEQKPSKPAAPQVPPKKPTAPTKASNLLRSPGAVYPKRPEKPVPPP
PPAAKINGEVSIISSKIDTEPVSKPKLDPEQLPVRPKSVDLDAFVARNSKETDDVNFDDI
ASSENLLHLTANRPKMPGRRLPGRFNGGHSPTQSPEKTLKLPKEDDSGNLKPLEFKKDAS
YSSKSSLSTPSSASKVNTAAFLTPLELKAKAEADDGKRNSVDELRAQIIELLCIVDALKK
DHGKELEKLRKELEEEKAMRSNLEVEIAKLKKAVLLS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggttgactatattgtggaatatgactatgatgctgtacatgatgatgagttaactatc
cgagttggggaaatcatcagaaatgtgaaaaaactacaggaagaaggatggctagaagga
gaactaaatgggagacgagggatgttccctgacaattttgttaaggaaattaagcgagag
acagaacccaaggatgacaatttgcccatcaaacgggaaaggcaaggaaatgtagcaagt
cttgtacagcgaatcagcacttatggacttccagctggaggaattcagccacatccacaa
accaaagctattaagaagaagacaaaaaagcgtcagtgtaaagttctttttgactactct
ccacaaaatgaggacgaactggaattgatcgtgggggatgtcattgacgtcattgaagag
gtagaagaaggctggtggagtggaaccctgaacaataagttgggactgtttccctcaaac
tttgtgaaagaattagagtccacagaggatggtgaaactcacaacgctcaggaggaatca
gaagttcctttgactggccctacctcaccgttgccatctccggggaatgggagtgaacct
gctcccggatcagttgcacagccaaagaaaatccgaggaattggatttggagacatcttt
aaagaaggctctgtgaaacttcggacaagaacttccagtagtgaaacagaggagaaaaaa
acagaaaagcctttaatcctacagcctctgggatctagaactcagaatgtggaggtaaca
aaaccagacgttgatggcaagattaaagctaaggaatattgtagaacattatttccctat
acaggaaccaatgaagatgaacttacatttagagaaggggagattatccatttgataagt
aaggagactggagaagcaggctggtggaagggtgaactgaacggtaaagaaggagtgttt
ccagataactttgctgttcagataagtgaactagataaagactttccaaaaccaaagaaa
ccacctcctcctgcaaaaggtccagctccaaagcctgacctgtcagctgcagagaagaaa
gctttccctctaaaggctgaagaaaaagatgaaaaatcactgttagaacagaaaccttct
aaaccagctgctcctcaagtcccgcccaaaaagcccactgcacccaccaaagccagtaac
ttactgaggtcgcctggagcagtgtacccaaagcggccagaaaagccagtccctccgcca
cctccagcagccaaaattaatggagaagtttctataatttcttcaaagattgatactgag
ccagtatcaaaaccaaagctagatcctgaacaattgccagttagaccaaaatcagtagac
cttgatgcctttgtagccaggaactcaaaagaaacagatgatgtaaattttgatgacata
gcttcctcagagaacttgttacatctcactgctaatagacccaagatgcctggaagacga
ttgcctggccgcttcaacggtggacattctccaacccaaagcccagaaaaaaccttgaag
ctaccaaaagaagatgatagtggcaacctaaagcctttggagtttaaaaaggatgcaagc
tactcttcaaagtcatctctttcaacaccttcaagtgcttctaaagtaaatacagctgct
ttcctaactccgttagaactcaaagctaaagcagaagcagatgatgggaaaagaaattcc
gtggacgaacttagagcccagattattgaattgttgtgtattgtagatgcactgaaaaag
gatcatgggaaagaactggaaaagctacgcaaagaattagaagaagagaaggccatgcga
agtaatctagaggtggaaatagcaaagctgaagaaagctgttctgttgtcttga

DBGET integrated database retrieval system