KEGG   Mus musculus (mouse): 12568Help
Entry
12568             CDS       T01002                                 

Gene name
Cdk5, AW048668, Crk6
Definition
(RefSeq) cyclin-dependent kinase 5 (EC:2.7.11.1)
  KO
K02090  
cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
Axon guidance
Alzheimer's disease
Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04360 Axon guidance
    12568 (Cdk5)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12568 (Cdk5)
  Substance dependence
   05030 Cocaine addiction
    12568 (Cdk5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12568 (Cdk5)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   12568 (Cdk5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 A3-B1; 5 11.73 cM
AA seq 292 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggagaagattggggaaggcacctatggaactgtgttcaag
gctaaaaaccgggaaactcatgagattgtggctctgaagcgtgtcaggctggatgatgac
gatgagggtgtgccaagttcagccctccgggagatctgtctactcaaagaactgaagcac
aaaaacattgtcaggcttcatgatgtcctgcatagtgacaagaagctgacactggttttt
gagttctgtgatcaggacctgaagaaatatttcgacagctgcaatggtgacctggaccct
gagattgtgaagtcattcctcttccagctgctgaaaggcctgggattctgtcacagccgc
aacgtgctacatagggacctgaagccccagaacctgctcataaacaggaatggggagttg
aaattggctgattttggcctggcccgagcctttggtatccccgtccgctgctactctgct
gaggtggtcacgctgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatctttgcagagctggctaatgcaggacga
cctctcttccctggcaatgatgtggatgaccagctgaagaggatcttccgactgctaggg
acaccgactgaggaacaatggcctgccatgaccaagctgccagactataagccctaccca
atgtacccagctacaacatccttggtgaacgtcgtgcccaagctcaatgccacggggagg
gacctgttgcagaacctattgaagtgtaaccctgtgcagcgcatctcagcagaggaggcc
ttgcagcacccctacttctctgacttctgtcccccatag

DBGET integrated database retrieval system