KEGG   Mus musculus (mouse): 12581Help
Entry
12581             CDS       T01002                                 

Gene name
Cdkn2d, INK4d, p19, p19INK4d
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    12581 (Cdkn2d)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12581 (Cdkn2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 A3; 9
AA seq 166 aa AA seqDB search
MLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALEL
LKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHS
SVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggaagaagtctgcgtcggcgaccggttgagtggcgcagcggcccgtggcgac
gtgcaagaggtccgccgccttcttcaccgggagctggtgcatcctgacgccctgaaccgc
tttggcaagacggccttgcaggtcatgatgtttggaagtccagcagttgctttggagctc
ctgaagcaaggtgccagccccaatgtccaagatgcctccggtactagtcctgtgcatgat
gcggctcgcaccgggttcctggacaccctgaaggttctggtggagcatggtgctgatgtc
aatgccctggacagcactgggtcgctccccatccatctggcgataagagagggccatagc
tccgtggtcagcttcctagctcctgaatctgatctccaccacagggacgcttccggtctc
actcccctggagttggctcggcagagaggggctcagaacctcatggacattctgcagggg
cacatgatgatcccaatgtga

DBGET integrated database retrieval system