KEGG   Mus musculus (mouse): 13864Help
Entry
13864             CDS       T01002                                 

Gene name
Nr2f6, AV090102, COUP-TF3, EAR2, Erbal2
Definition
(RefSeq) nuclear receptor subfamily 2, group F, member 6
  KO
K08549  
nuclear receptor subfamily 2 group F member 6
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    13864 (Nr2f6)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   13864 (Nr2f6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 B3.3; 8 34.43 cM
AA seq 390 aa AA seqDB search
MAMVTGGWGDPGGDTNGVDKAGGSYPRATEDDSASPPGATSDAEPGDEERPGLQVDCVVC
GDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRV
GMRKEAVQRGRIPHALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEPYPAAGRFGGG
GAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQAALP
LHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDAAEYGCLKAIALFTP
DACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFF
MRLVGKTPIETLIRDMLLSGSTFNWPYGSG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccatggtgaccggtggctggggcgaccccggaggcgacacgaacggcgtggacaag
gctggtgggagctacccacgcgcgaccgaggacgattcggcgtcacctcccggggcgacc
agcgacgcggagccgggcgacgaggagcgtccggggttgcaggtggactgcgtggtgtgc
ggggacaagtccagtggaaagcattacggcgtgttcacctgcgagggctgcaagagtttc
ttcaagcgcagcatccgccgcaatctcagctacacctgccggtccaaccgtgactgtcag
attgatcagcaccaccggaaccagtgtcagtactgtcggctcaagaagtgcttccgggtg
ggcatgcgcaaggaggccgtgcagcgaggccgcatcccgcatgcgctccccggtccagcg
gcctgcagtcccccgggcgcgacgggcgtcgaacctttcacggggccgccagtgtccgag
ctgattgcgcagctgctgcgtgctgagccctaccccgcggccggacgctttggtggcggc
ggcgctgtactgggcatcgacaacgtgtgcgagttggcggcacgcctgctgttcagcacg
gtcgagtgggcccgccacgcgcccttcttccccgagctgccggccgccgaccaggtggcg
ctgctgcggctcagctggagtgagctcttcgtgctgaacgcggcgcaggcggcgctgccg
ctgcatacggcaccgctgctggccgccgcggggttgcatgccgcgcccatggcagccgag
cgggccgtggccttcatggaccaggtgcgtgccttccaggagcaggtggacaagctgggc
cgcctgcaggtggatgctgcggagtacggctgcctcaaggccatcgcgctcttcacgcct
gatgcctgtggcctttctgacccagcccatgtggagagcctgcaggagaaggcacaggtg
gccctcaccgagtatgtgcgtgcccagtacccatcgcagccccagcgctttgggcgtctg
ctgctgcggctgccagccctgcgtgctgtgcccgcatccctcatctcccagctcttcttc
atgcgcctggtgggcaagacacccatcgagaccctcatccgggacatgcttctgtcaggg
agcacctttaactggccctatggctcgggctag

DBGET integrated database retrieval system