KEGG   Mus musculus (mouse): 13869Help
Entry
13869             CDS       T01002                                 

Gene name
Erbb4, Her4, c-erbB-4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4 (EC:2.7.10.1)
  KO
K05085  
receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Endocytosis
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    13869 (Erbb4)
   04020 Calcium signaling pathway
    13869 (Erbb4)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    13869 (Erbb4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    13869 (Erbb4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13869 (Erbb4)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  EGFR family [OT]
   13869 (Erbb4)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   13869 (Erbb4)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   13869 (Erbb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C3; 1 33.8 cM
AA seq 1292 aa AA seqDB search
MKLATGLWVWGSLLMAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYD
GEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRTRIDSNRNQFVYQDGGFATQQGMPMPYRATTSTIPEAPVAQG
ATAEMFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERNPRGELDEEGYMTPMHD
KPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAEDEYVNEPLYLNTFANAL
GSAEYMKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggcgacgggactctgggtctgggggagccttctgatggcagcggggaccgtc
cagcccagcgcttctcagtcagtgtgcgcaggaacagagaacaaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaaatactatgaaaactgcgaggtagtcatg
ggcaacctggagatcaccagcatcgagcacaaccgggacctctccttcctgcggtctatc
cgagaagtcacaggctacgtcctggtggccctcaaccagtttcgttacttgcctctggag
aatttacgcattattcgtgggacaaaactatatgaagatcgctatgccttagcgatattc
ttaaactacaggaaagatggcaactttggactccaagaacttggattaaagaacctgacc
gaaatactaaatggtggagtctatgtagaccagaacaaattcctatgttatgctgacact
atacactggcaagatattgttcggaatccatggccttccaacatgactctggtgtcaaca
aatggaagttctggatgtggaagatgccataagtcttgcactggccgatgctggggaccc
acagaaaatcactgccagaccttgaccagaactgtgtgtgctgaacaatgtgatggcagg
tgctatggaccctacgttagtgactgctgccatcgagaatgtgctggaggctgctcagga
ccaaaggacactgactgctttgcctgcatgaacttcaatgacagtggagcctgcgttact
caatgtccccaaacatttgtctacaatccaaccacctttcaactggaacacaacttcaat
gcaaagtacacgtatggagcattctgtgttaagaaatgtccacataacttcgtggtagat
tccagttcttgtgtacgagcctgccctagttctaagatggaagtagaagaaaatgggatt
aaaatgtgtaagccttgcaccgatatttgccccaaagcatgtgatggaatcggcacggga
tcactgatgtctgctcagactgtggattcaagtaacattgacaaattcataaactgcaca
aagatcaatggcaatctcatctttcttgtcactggcattcatggagacccttacaatgct
attgacgccatagatccagagaaactgaatgtctttcggactgtcagagaaataacaggt
ttcctgaacatacagtcttggcccccaaatatgacagatttcagtgttttctccaacctc
gtcacaattggaggaagagtcctctacagtggtctctcattgctgatcctcaaacaacaa
ggtatcacttccctacagttccagtctctgaaggaaatcagtgcgggcaatatctacatc
actgacaacagcaacctgtgttattaccataccattaactggacaacactcttcagcacc
attaaccagagaatagtgatccgagataacagaagagctgagaattgtactgctgaaggc
atggtatgcaaccacctgtgttcaaatgatggttgttggggacctgggccggaccagtgc
ctgtcatgtcggcgcttcagcaggggaaagatctgcatagagtcttgcaacctttatgat
ggggaatttcgagagtttgaaaacggctccatctgtgttgagtgtgactcccagtgtgag
aaaatggaagatggactcctcacatgccatggaccgggacctgacaactgcacaaagtgc
tctcattttaaggatggtccaaactgtgtggagaaatgtccagatggcctacagggagca
aacagtttcatttttaagtatgcagatcaggatcgggagtgccacccttgccatccaaac
tgcacccaggggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacacgctagaactccactgattgcagccggagtcattggaggc
ctcttcatcctggtgatcatggctttgacatttgctgtctatgtcagaagaaagagcatc
aaaaagaaacgtgctttgaggagattcctggagacagagctggtagagcccttaactccc
agtggcacggcacccaatcaagctcaacttcgcattttgaaggaaaccgaactaaagagg
gtaaaggtccttggctcgggagcttttggaaccgtttataaaggtatttgggtgcctgaa
ggtgaaacagtgaaaatccctgtggctataaagatcctcaatgaaacaactggccccaaa
gccaacgtggagttcatggatgaggctctgatcatggcaagtatggatcacccacaccta
gttcgcctattgggagtgtgtctgagtcccactatccagttggttacgcagctgatgccg
catggctgcctactggactatgttcatgaacacaaggataacattggatcacagctgctg
ttgaactggtgtgtccagattgctaagggaatgatgtacctagaagaaagacggcttgtt
catcgggatctggcagcccgcaatgtcttagtgaaatctccaaatcatgttaaaatcaca
gattttggactggcccggctcttggaaggagatgaaaaagaatacaatgctgatggtggc
aagatgccaattaaatggatggctctggaatgtatacattataggaaattcacacatcaa
agtgatgtttggagctatggcgtcactatatgggaactgatgacctttggaggaaagccc
tatgatggaattccaacccgagaaatccccgatttactggagaaaggagagcgtctgcct
cagcctcccatctgcactattgatgtttacatggtcatggtcaaatgttggatgatcgat
gctgacagcagacctaaattcaaagaactggctgctgagttttcaagaatggctagagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaaattcttccagaatctcttggatgaagaggatttggaagacatgatggatgctgag
gaatatttggtcccccaggctttcaacatacctcctcccatctacacatccagaacaaga
attgactccaataggaatcagtttgtgtaccaagatgggggctttgctacacaacaagga
atgcccatgccctacagagccacaaccagcaccataccagaggctccagtagctcagggt
gcaacggctgagatgtttgatgactcctgctgtaatggtaccctacgaaagccagtggca
ccccatgtccaagaggacagtagcactcagaggtatagtgctgatcccacagtgttcgcc
ccagaacggaatcctcgaggagaactggatgaagaaggctacatgactccaatgcatgac
aagcccaaacaagaatatctgaatcctgtggaagagaacccttttgtgtcccgaaggaag
aatggagatcttcaagctttagataatccggagtatcacagtgcttccagcggtccaccc
aaggcggaggatgaatacgtgaatgagcctctatacctcaacaccttcgccaatgccttg
gggagtgcagagtacatgaaaaacagtgtactgtctgtgccagagaaagccaagaaagca
tttgacaaccccgactactggaaccacagcctgccaccccggagcacccttcagcaccca
gactacctgcaggaatacagcacaaaatatttttataaacagaatggacggatccgcccc
attgtggcagagaatcctgagtacctctcggagttctcgctgaagcctggcactatgctg
ccccctccgccctacagacaccggaatactgtggtgtga

DBGET integrated database retrieval system