KEGG   Mus musculus (mouse): 13869Help
Entry
13869             CDS       T01002                                 

Gene name
Erbb4, Her4, c-erbB-4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  
receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    13869 (Erbb4)
   04020 Calcium signaling pathway
    13869 (Erbb4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    13869 (Erbb4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13869 (Erbb4)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  EGFR family [OT]
   13869 (Erbb4)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   13869 (Erbb4)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   13869 (Erbb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C3; 1 33.8 cM
AA seq 1292 aa AA seqDB search
MKLATGLWVWGSLLMAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYD
GEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRTRIDSNRNQFVYQDGGFATQQGMPMPYRATTSTIPEAPVAQG
ATAEMFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERNPRGELDEEGYMTPMHD
KPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAEDEYVNEPLYLNTFANAL
GSAEYMKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggcgacgggactctgggtctgggggagccttctgatggcagcggggaccgtc
cagcccagcgcttctcagtcagtgtgcgcaggaacagagaacaaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaaatactatgaaaactgcgaggtagtcatg
ggcaacctggagatcaccagcatcgagcacaaccgggacctctccttcctgcggtctatc
cgagaagtcacaggctacgtcctggtggccctcaaccagtttcgttacttgcctctggag
aatttacgcattattcgtgggacaaaactatatgaagatcgctatgccttagcgatattc
ttaaactacaggaaagatggcaactttggactccaagaacttggattaaagaacctgacc
gaaatactaaatggtggagtctatgtagaccagaacaaattcctatgttatgctgacact
atacactggcaagatattgttcggaatccatggccttccaacatgactctggtgtcaaca
aatggaagttctggatgtggaagatgccataagtcttgcactggccgatgctggggaccc
acagaaaatcactgccagaccttgaccagaactgtgtgtgctgaacaatgtgatggcagg
tgctatggaccctacgttagtgactgctgccatcgagaatgtgctggaggctgctcagga
ccaaaggacactgactgctttgcctgcatgaacttcaatgacagtggagcctgcgttact
caatgtccccaaacatttgtctacaatccaaccacctttcaactggaacacaacttcaat
gcaaagtacacgtatggagcattctgtgttaagaaatgtccacataacttcgtggtagat
tccagttcttgtgtacgagcctgccctagttctaagatggaagtagaagaaaatgggatt
aaaatgtgtaagccttgcaccgatatttgccccaaagcatgtgatggaatcggcacggga
tcactgatgtctgctcagactgtggattcaagtaacattgacaaattcataaactgcaca
aagatcaatggcaatctcatctttcttgtcactggcattcatggagacccttacaatgct
attgacgccatagatccagagaaactgaatgtctttcggactgtcagagaaataacaggt
ttcctgaacatacagtcttggcccccaaatatgacagatttcagtgttttctccaacctc
gtcacaattggaggaagagtcctctacagtggtctctcattgctgatcctcaaacaacaa
ggtatcacttccctacagttccagtctctgaaggaaatcagtgcgggcaatatctacatc
actgacaacagcaacctgtgttattaccataccattaactggacaacactcttcagcacc
attaaccagagaatagtgatccgagataacagaagagctgagaattgtactgctgaaggc
atggtatgcaaccacctgtgttcaaatgatggttgttggggacctgggccggaccagtgc
ctgtcatgtcggcgcttcagcaggggaaagatctgcatagagtcttgcaacctttatgat
ggggaatttcgagagtttgaaaacggctccatctgtgttgagtgtgactcccagtgtgag
aaaatggaagatggactcctcacatgccatggaccgggacctgacaactgcacaaagtgc
tctcattttaaggatggtccaaactgtgtggagaaatgtccagatggcctacagggagca
aacagtttcatttttaagtatgcagatcaggatcgggagtgccacccttgccatccaaac
tgcacccaggggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacacgctagaactccactgattgcagccggagtcattggaggc
ctcttcatcctggtgatcatggctttgacatttgctgtctatgtcagaagaaagagcatc
aaaaagaaacgtgctttgaggagattcctggagacagagctggtagagcccttaactccc
agtggcacggcacccaatcaagctcaacttcgcattttgaaggaaaccgaactaaagagg
gtaaaggtccttggctcgggagcttttggaaccgtttataaaggtatttgggtgcctgaa
ggtgaaacagtgaaaatccctgtggctataaagatcctcaatgaaacaactggccccaaa
gccaacgtggagttcatggatgaggctctgatcatggcaagtatggatcacccacaccta
gttcgcctattgggagtgtgtctgagtcccactatccagttggttacgcagctgatgccg
catggctgcctactggactatgttcatgaacacaaggataacattggatcacagctgctg
ttgaactggtgtgtccagattgctaagggaatgatgtacctagaagaaagacggcttgtt
catcgggatctggcagcccgcaatgtcttagtgaaatctccaaatcatgttaaaatcaca
gattttggactggcccggctcttggaaggagatgaaaaagaatacaatgctgatggtggc
aagatgccaattaaatggatggctctggaatgtatacattataggaaattcacacatcaa
agtgatgtttggagctatggcgtcactatatgggaactgatgacctttggaggaaagccc
tatgatggaattccaacccgagaaatccccgatttactggagaaaggagagcgtctgcct
cagcctcccatctgcactattgatgtttacatggtcatggtcaaatgttggatgatcgat
gctgacagcagacctaaattcaaagaactggctgctgagttttcaagaatggctagagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaaattcttccagaatctcttggatgaagaggatttggaagacatgatggatgctgag
gaatatttggtcccccaggctttcaacatacctcctcccatctacacatccagaacaaga
attgactccaataggaatcagtttgtgtaccaagatgggggctttgctacacaacaagga
atgcccatgccctacagagccacaaccagcaccataccagaggctccagtagctcagggt
gcaacggctgagatgtttgatgactcctgctgtaatggtaccctacgaaagccagtggca
ccccatgtccaagaggacagtagcactcagaggtatagtgctgatcccacagtgttcgcc
ccagaacggaatcctcgaggagaactggatgaagaaggctacatgactccaatgcatgac
aagcccaaacaagaatatctgaatcctgtggaagagaacccttttgtgtcccgaaggaag
aatggagatcttcaagctttagataatccggagtatcacagtgcttccagcggtccaccc
aaggcggaggatgaatacgtgaatgagcctctatacctcaacaccttcgccaatgccttg
gggagtgcagagtacatgaaaaacagtgtactgtctgtgccagagaaagccaagaaagca
tttgacaaccccgactactggaaccacagcctgccaccccggagcacccttcagcaccca
gactacctgcaggaatacagcacaaaatatttttataaacagaatggacggatccgcccc
attgtggcagagaatcctgagtacctctcggagttctcgctgaagcctggcactatgctg
ccccctccgccctacagacaccggaatactgtggtgtga

DBGET integrated database retrieval system