KEGG   Mus musculus (mouse): 14066Help
Entry
14066             CDS       T01002                                 

Gene name
F3, AA409063, CD142, Cf-3, Cf3, TF
Definition
(RefSeq) coagulation factor III
  KO
K03901  
coagulation factor III (tissue factor)
Organism
mmu  Mus musculus (mouse)
Pathway
Complement and coagulation cascades
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    14066 (F3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    14066 (F3)
Cellular antigens [BR:mmu04090]
 Proteins
  14066 (F3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  14066 (F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 G1; 3 52.94 cM
AA seq 294 aa AA seqDB search
MAILVRPRLLAALAPTFLGCLLLQVTAGAGIPEKAFNLTWISTDFKTILEWQPKPTNYTY
TVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIH
GEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFG
KDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTV
CTEQWKSFLGETLIIVGAVVLLATIFIILLSISLCKRRKNRAGQKGKNTPSRLA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcctcgtgcgcccgcgcctcctagcggctctcgcgcccacgtttctcggctgc
ctcctcctccaggtgaccgcgggtgcaggcattccagagaaagcgtttaatttaacttgg
atatcaactgatttcaagacaattttggagtggcaacccaaacccaccaactatacctac
actgtacagataagtgatcgatctagaaactggaaaaacaagtgcttctcgaccacagac
accgagtgcgacctcacagacgagatcgtgaaggatgtgacctgggcctatgaagcaaag
gtcctctctgtcccacggaggaactcagttcatggagacggagaccaacttgtgattcat
ggggaggagccgccatttacaaacgccccaaagtttttaccttaccgagacacaaacctt
ggacagccagtaattcagcagtttgaacaagatggtagaaaactgaacgtggttgtaaaa
gactcacttacattagtcagaaagaatggtacattcctcaccctgcggcaagtctttggc
aaggacttgggttatataattacttatcggaaaggctcaagcacgggaaagaaaacaaac
attacaaacaccaatgaattctcgattgatgtggaagaaggagtaagctactgctttttt
gtacaagctatgattttctccaggaaaactaaccaaaatagcccaggaagcagtacagtg
tgcaccgagcaatggaagagtttcctgggagaaacactcatcattgtgggagcagtggtg
ctcctggccaccatctttatcatcctcctgtccatatctctgtgcaagcgcagaaagaac
cgagcgggacagaaagggaagaacaccccgtcgcgcttggcatag

DBGET integrated database retrieval system