KEGG   Mus musculus (mouse): 14083Help
Entry
14083             CDS       T01002                                 

Gene name
Ptk2, FAK, FRNK, Fadk, mKIAA4203, p125FAK
Definition
(RefSeq) PTK2 protein tyrosine kinase 2 (EC:2.7.10.2)
  KO
K05725  
focal adhesion kinase 1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Amoebiasis
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    14083 (Ptk2)
   04370 VEGF signaling pathway
    14083 (Ptk2)
   04151 PI3K-Akt signaling pathway
    14083 (Ptk2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    14083 (Ptk2)
  Cellular commiunity
   04510 Focal adhesion
    14083 (Ptk2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    14083 (Ptk2)
   04062 Chemokine signaling pathway
    14083 (Ptk2)
  Development
   04360 Axon guidance
    14083 (Ptk2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14083 (Ptk2)
   05202 Transcriptional misregulation in cancers
    14083 (Ptk2)
   05205 Proteoglycans in cancer
    14083 (Ptk2)
   05222 Small cell lung cancer
    14083 (Ptk2)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    14083 (Ptk2)
   05146 Amoebiasis
    14083 (Ptk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     14083 (Ptk2)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  FAK family
   14083 (Ptk2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     14083 (Ptk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
15 D3; 15 33.94 cM
AA seq 1052 aa AA seqDB search
MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQE
MSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcttatcttgacccaaacttgaatcacacaccaagttcgagtactaagact
cacctgggtactggcatggaacggtcccctggtgcaatggaacgagtattaaaggtcttt
cattattttgaaagcagtagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcacgtg
gcctgctatggatttcgcctcagtcacctgcgatcggaggaggtgcactggctgcacgtg
gacatgggtgtctccagtgtgagggagaaatatgaactcgcccacccaccagaggagtgg
aaatatgagttgagaattcgttacttgccaaaaggatttctaaaccagtttactgaagat
aagccaacattgaatttcttctatcaacaggtgaagagtgactacatgcaagaaatagct
gatcaagtagaccaagaaatagctttgaagttgggttgtttggaaattaggcgatcctat
tgggagatgaggggtaatgccctagagaagaagtccaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaagctgatccagcaaacattcaggcagtttgccaaccttaatagagaagaaagcatc
ctgaaattctttgagattctttctcctgtgtacagatttgacaaagagtgcttcaagtgt
gcccttgggtcaagttggatcatttctgtggaattggcaatcggcccagaagaagggatc
agttacctgacagacaaaggctgcaatcccacacacctagcagactttaaccaagtgcag
accatccagtactcaaacagtgaagacaaagacaggaaaggaatgctacaactcaaaatc
gctggtgctcctgagcctctgaccgtgacggcaccatccctaaccattgccgagaacatg
gccgacctgattgatggatactgccggctggtgaatggagccacacaatctttcatcatc
agaccccagaaagaaggtgaacgggcgttgccatcaataccaaagttggccaacagtgaa
aagcaaggcatgcggacacatgcagtctctgtgtcagagacagatgactatgcagagatc
atcgatgaggaagacacatacaccatgccctcgaccagggattatgagattcagagagaa
agaatagaacttggacgctgtattggagaaggtcagtttggagatgtacatcaaggcgtg
tacctgagcccagagaatccagctttggctgttgcaatcaaaacatgtaaaaactgtact
tcggacagcgtgagagagaagttccttcaagaagccttaacaatgcgtcagtttgaccat
cctcacatcgtgaagctgattggagtcattacagagaaccctgtctggataatcatggag
ttgtgcacacttggagagctgaggtcatttttgcaagtaagaaaatacagcttggacctg
gcatctttgatattatatgcctatcagcttagtacagcactcgcgtatctggagagcaaa
agatttgttcacagggacattgctgctcggaatgttctggtgtcttcaaatgattgtgta
aaattgggagactttggattatctcgatatatggaagacagtacttactataaagcttcc
aaaggaaaattacctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtgtggatgtttggtgtgtgtatgtgggagatactgatgcatggcgtg
aagccttttcaaggagtgaagaacaatgatgtgatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcccaccctctacagccttatgacgaaatgttgggcc
tatgaccccagcaggcggcccaggtttactgaactaaaagctcagctcagcacaatcctg
gaggaggagaaggtgcagcaagaagaacggatgaggatggaatccagaagacaggctacc
gtgtcctgggactctggagggtctgatgaagcaccacccaagcccagcagacctggttat
cctagcccgagatccagtgaaggattttatcccagcccacagcacatggtccagaccaat
cactaccaggtctctggctacccgggttcccatggaatcccagccatggctggcagcatt
taccaaggtcaggcatctcttctggaccagacagaattgtggaatcacagacctcaggag
atgtccatgtggcagcccagtgtggaggattcggcagctttggaccttcgagggatggga
caggtgcttccccctcacctgatggaagagcggctaatccgacagcagcaggaaatggaa
gaagaccagcgctggctggagaaggaagagcgattcctgaaacctgatgtgaggctctct
cgaggcagcatcgacagggaagacgggagttttcagggtccgactggaaaccaacacatc
tatcagcctgtggggaagccagatcctgcagctccaccaaagaaacctcctcgccctgga
gcacctggccacctaagcaacctgtccagcatcagcagccctgcagacagctacaatgag
ggtgtcaagcttcagccccaggaaatcagcccccctcccactgccaaccttgaccggtcc
aatgacaaggtatatgaaaatgtgacaggcctagtgaaggctgtcatcgagatgtccagc
aaaatccagccagctcctccagaagagtacgtccctatggtgaaggaagttggcctggcc
ctgcggaccttactagccacggtggatgagaccattcctgctcttccagccagcactcat
cgagagatcgagatggcacagaagctgctgaactccgacttaggcgagctcatcagcaag
atgaagctggcgcagcagtacgtcatgaccagcctgcagcaggagtataagaagcagatg
ctgacagctgctcacgccctggctgtggatgccaagaacctacttgatgttattgatcaa
gcaagactgaaaatgctagggcagacacggccacactga

DBGET integrated database retrieval system