KEGG   Mus musculus (mouse): 14378Help
Entry
14378             CDS       T01002                                 

Gene name
G6pc2, G6pc-rs, IGRP
Definition
(RefSeq) glucose-6-phosphatase, catalytic, 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14378 (G6pc2)
   00052 Galactose metabolism
    14378 (G6pc2)
   00500 Starch and sucrose metabolism
    14378 (G6pc2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    14378 (G6pc2)
   04151 PI3K-Akt signaling pathway
    14378 (G6pc2)
   04152 AMPK signaling pathway
    14378 (G6pc2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    14378 (G6pc2)
   04922 Glucagon signaling pathway
    14378 (G6pc2)
   04920 Adipocytokine signaling pathway
    14378 (G6pc2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    14378 (G6pc2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    14378 (G6pc2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     14378 (G6pc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 14378
NCBI-ProteinID: NP_067306
MGI: 1277193
Ensembl: ENSMUSG00000005232
Vega: OTTMUSG00000012981
UniProt: Q9Z186
Position
2 C2; 2 39.66 cM
AA seq 355 aa AA seqDB search
MDFLHRSGVLIIHHLQEDYRTYYGFLNFMSNVGDPRNIFSIYFPLWFQLNQNVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWIQETEIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSYTISRMEESSVTLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGVHMASLSVYLKTNVFLFLFALGFYLLLRLFGIDLLWSVPIAK
KWCANPDWIHIDSTPFAGLVRNLGVLFGLGFAINSEMFLRSCQGENGTKPSFRLLCALTS
LTTMQLYRFIKIPTHAEPLFYLLSFCKSASIPLMVVALIPYCVHMLMRPGDKKTK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggagtggagtgcttattattcatcatctgcaggaggactaccgg
acttactatggttttctaaattttatgtccaatgttggagacccccgaaatatcttttct
atttacttcccactttggtttcagttgaatcagaatgttggaaccaagatgatctgggta
gcggtcataggggactggttcaatctcatatttaaatggatattgtttggccatcgtcct
tactggtggatacaagaaactgagatttatccaaatcattcaagcccatgtcttgagcag
tttcctactacgtgtgaaacaggcccaggaagtccatctggccacgcaatgggctcatcg
tgcgtctggtatgtcatggtaacagctgccctaagctacaccatcagccggatggaggag
tcctctgtcactctgcacagactgacctggtcctttctgtggagtgttttctggttgatt
caaatcagcgtctgcatctcaagagtattcatagccacacatttcccccatcaggtcatt
cttggagtgattggtgggatgctagtagccgaggcctttgaacacactccaggagtccac
atggccagcttgagtgtgtacctgaagaccaacgtcttcctcttcctgtttgccctcggc
ttttacctgcttctccgactgttcggtattgacctgctgtggtccgtgcccatcgccaaa
aagtggtgtgccaacccagactggatccacattgacagcacgccttttgctggactcgtg
agaaacctcggggtcctctttggcttgggtttcgccatcaactcagaaatgttccttcgg
agctgccagggagaaaatggcaccaagccgagcttccgcttgctctgtgctctgacctca
ctgaccacaatgcaactttatcgcttcatcaagatcccgactcacgcggaacctttattt
tacctgttgtctttctgtaaaagtgcgtccatccccctgatggtggtggctctaattccc
tactgtgtacatatgttaatgagacccggtgacaagaagactaaatag

DBGET integrated database retrieval system