KEGG   Mus musculus (mouse): 14378Help
Entry
14378             CDS       T01002                                 

Gene name
G6pc2, G6pc-rs, IGRP
Definition
glucose-6-phosphatase, catalytic, 2 (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmu00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mmu04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mmu04920]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:mmu04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C2; 2 39.66 cM
AA seq 355 aa AA seqDB search
MDFLHRSGVLIIHHLQEDYRTYYGFLNFMSNVGDPRNIFSIYFPLWFQLNQNVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWIQETEIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSYTISRMEESSVTLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGVHMASLSVYLKTNVFLFLFALGFYLLLRLFGIDLLWSVPIAK
KWCANPDWIHIDSTPFAGLVRNLGVLFGLGFAINSEMFLRSCQGENGTKPSFRLLCALTS
LTTMQLYRFIKIPTHAEPLFYLLSFCKSASIPLMVVALIPYCVHMLMRPGDKKTK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggagtggagtgcttattattcatcatctgcaggaggactaccgg
acttactatggttttctaaattttatgtccaatgttggagacccccgaaatatcttttct
atttacttcccactttggtttcagttgaatcagaatgttggaaccaagatgatctgggta
gcggtcataggggactggttcaatctcatatttaaatggatattgtttggccatcgtcct
tactggtggatacaagaaactgagatttatccaaatcattcaagcccatgtcttgagcag
tttcctactacgtgtgaaacaggcccaggaagtccatctggccacgcaatgggctcatcg
tgcgtctggtatgtcatggtaacagctgccctaagctacaccatcagccggatggaggag
tcctctgtcactctgcacagactgacctggtcctttctgtggagtgttttctggttgatt
caaatcagcgtctgcatctcaagagtattcatagccacacatttcccccatcaggtcatt
cttggagtgattggtgggatgctagtagccgaggcctttgaacacactccaggagtccac
atggccagcttgagtgtgtacctgaagaccaacgtcttcctcttcctgtttgccctcggc
ttttacctgcttctccgactgttcggtattgacctgctgtggtccgtgcccatcgccaaa
aagtggtgtgccaacccagactggatccacattgacagcacgccttttgctggactcgtg
agaaacctcggggtcctctttggcttgggtttcgccatcaactcagaaatgttccttcgg
agctgccagggagaaaatggcaccaagccgagcttccgcttgctctgtgctctgacctca
ctgaccacaatgcaactttatcgcttcatcaagatcccgactcacgcggaacctttattt
tacctgttgtctttctgtaaaagtgcgtccatccccctgatggtggtggctctaattccc
tactgtgtacatatgttaatgagacccggtgacaagaagactaaatag

DBGET integrated database retrieval system