KEGG   Mus musculus (mouse): 14466Help
Entry
14466             CDS       T01002                                 

Gene name
Gba, GBA1, GC, GCase, GLUC, betaGC
Definition
(RefSeq) glucosidase, beta, acid
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    14466 (Gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    14466 (Gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    14466 (Gba)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     14466 (Gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 14466
NCBI-ProteinID: NP_001070879
MGI: 95665
Ensembl: ENSMUSG00000028048
Vega: OTTMUSG00000052631
UniProt: P17439
Position
3 F1; 3 39.01 cM
AA seq 515 aa AA seqDB search
MAARLIGFFLFQAVSWAYGAQPCIPKSFGYSSVVCVCNASYCDSLDPVTLPALGTFSRYE
STRRGRRMELSVGAIQANRTGTGLLLTLQPEKKFQKVKGFGGAMTDATALNILALSPPTQ
KLLLRSYFSTNGIEYNIIRVPMASCDFSIRVYTYADTPNDFQLSNFSLPEEDTKLKIPLI
HQALKMSSRPISLFASPWTSPTWLKTNGRVNGKGSLKGQPGDIFHQTWANYFVKFLDAYA
KYGLRFWAVTAENEPTAGLFTGYPFQCLGFTPEHQRDFISRDLGPALANSSHDVKLLMLD
DQRLLLPRWAEVVLSDPEAAKYVHGIAVHWYMDFLAPAKATLGETHRLFPNTMLFASEAC
VGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVTGWTDWNLALNPEGGPNWVRNFVDSPI
IVDIPKDAFYKQPMFYHLGHFSKFIPEGSQRVALVASESTDLETVALLRPDGSAVVVVLN
RSSEDVPLTISDPDLGFLETVSPGYSIHTYLWRRQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggctcatcggattcttcctatttcaggcggtatcttgggcatatggtgcc
caaccctgcatccccaaaagctttggctacagctcagtggtctgtgtctgtaatgcatcg
tactgtgactctcttgaccccgtgaccttaccggctctgggtaccttcagccgttacgag
agcactcgacgtggacgtcggatggagctgagtgtcggggccatccaggccaatcgcact
ggcacagggttactactcactttgcagccagaaaagaagttccagaaagtgaaaggattt
ggaggcgccatgacagacgccactgcgctcaacatccttgctttgtccccacctactcag
aagctgctactcagatcctacttctctaccaacggaattgaatataacatcatccgggta
cccatggccagttgtgacttctccatccgtgtctatacctatgctgacacccctaacgac
ttccagttatccaacttcagcctcccagaagaagacaccaagctcaagatacccctgatt
caccaagccctgaagatgtcctcacgccccatttcactctttgccagtccctggacatca
cccacttggctcaagaccaatggaagagtgaatgggaaggggtcgctcaagggtcagcca
ggggatatctttcaccagacctgggccaattactttgtcaagtttctggatgcttatgct
aagtatggcctaagattctgggcagtgacagcggagaatgaacctacagcagggctcttc
acggggtaccccttccagtgcctgggcttcactcctgaacaccagagagacttcatttcc
cgtgacctagggccagcccttgccaacagttcccatgatgtgaagctactcatgctagat
gaccaacgcttgctgctaccccgctgggcagaggtggtgctctctgatccagaggcagct
aagtacgttcatggcattgctgttcactggtatatggatttcctggctccagccaaagct
actttaggagagacacaccgcttgttccccaacacaatgctctttgcttcggaggcctgc
gtgggctccaagttctgggaacagagtgttcggttgggctcctgggatcgagggatgcag
tacagtcacagcatcattacgaacctcctttaccacgtaactggatggacggactggaac
cttgccctgaatcctgaaggagggcccaactgggtccgcaactttgtcgatagccccatt
attgtcgacatccccaaagacgcattttacaaacagcccatgttctaccatcttggccac
ttcagcaagttcattcccgagggatcccagagagtggcgttggtggccagtgagagcact
gacttggaaacagtagcactgttacgccctgacggctctgcagttgtggtcgtgttaaac
cgatcttcggaggatgtccctcttaccatcagtgatcctgacctgggcttcctggagacc
gtgtcacctggctactccattcacacttacctgtggcgtcgccagtga

DBGET integrated database retrieval system