KEGG   Mus musculus (mouse): 14466Help
Entry
14466             CDS       T01002                                 

Gene name
Gba, GBA1, GC, GCase, GLUC, betaGC
Definition
glucosidase, beta, acid (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mmu  Mus musculus (mouse)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    14466 (Gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    14466 (Gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    14466 (Gba)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     14466 (Gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 F1; 3 39.01 cM
AA seq 515 aa AA seqDB search
MAARLIGFFLFQAVSWAYGAQPCIPKSFGYSSVVCVCNASYCDSLDPVTLPALGTFSRYE
STRRGRRMELSVGAIQANRTGTGLLLTLQPEKKFQKVKGFGGAMTDATALNILALSPPTQ
KLLLRSYFSTNGIEYNIIRVPMASCDFSIRVYTYADTPNDFQLSNFSLPEEDTKLKIPLI
HQALKMSSRPISLFASPWTSPTWLKTNGRVNGKGSLKGQPGDIFHQTWANYFVKFLDAYA
KYGLRFWAVTAENEPTAGLFTGYPFQCLGFTPEHQRDFISRDLGPALANSSHDVKLLMLD
DQRLLLPRWAEVVLSDPEAAKYVHGIAVHWYMDFLAPAKATLGETHRLFPNTMLFASEAC
VGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVTGWTDWNLALNPEGGPNWVRNFVDSPI
IVDIPKDAFYKQPMFYHLGHFSKFIPEGSQRVALVASESTDLETVALLRPDGSAVVVVLN
RSSEDVPLTISDPDLGFLETVSPGYSIHTYLWRRQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggctcatcggattcttcctatttcaggcggtatcttgggcatatggtgcc
caaccctgcatccccaaaagctttggctacagctcagtggtctgtgtctgtaatgcatcg
tactgtgactctcttgaccccgtgaccttaccggctctgggtaccttcagccgttacgag
agcactcgacgtggacgtcggatggagctgagtgtcggggccatccaggccaatcgcact
ggcacagggttactactcactttgcagccagaaaagaagttccagaaagtgaaaggattt
ggaggcgccatgacagacgccactgcgctcaacatccttgctttgtccccacctactcag
aagctgctactcagatcctacttctctaccaacggaattgaatataacatcatccgggta
cccatggccagttgtgacttctccatccgtgtctatacctatgctgacacccctaacgac
ttccagttatccaacttcagcctcccagaagaagacaccaagctcaagatacccctgatt
caccaagccctgaagatgtcctcacgccccatttcactctttgccagtccctggacatca
cccacttggctcaagaccaatggaagagtgaatgggaaggggtcgctcaagggtcagcca
ggggatatctttcaccagacctgggccaattactttgtcaagtttctggatgcttatgct
aagtatggcctaagattctgggcagtgacagcggagaatgaacctacagcagggctcttc
acggggtaccccttccagtgcctgggcttcactcctgaacaccagagagacttcatttcc
cgtgacctagggccagcccttgccaacagttcccatgatgtgaagctactcatgctagat
gaccaacgcttgctgctaccccgctgggcagaggtggtgctctctgatccagaggcagct
aagtacgttcatggcattgctgttcactggtatatggatttcctggctccagccaaagct
actttaggagagacacaccgcttgttccccaacacaatgctctttgcttcggaggcctgc
gtgggctccaagttctgggaacagagtgttcggttgggctcctgggatcgagggatgcag
tacagtcacagcatcattacgaacctcctttaccacgtaactggatggacggactggaac
cttgccctgaatcctgaaggagggcccaactgggtccgcaactttgtcgatagccccatt
attgtcgacatccccaaagacgcattttacaaacagcccatgttctaccatcttggccac
ttcagcaagttcattcccgagggatcccagagagtggcgttggtggccagtgagagcact
gacttggaaacagtagcactgttacgccctgacggctctgcagttgtggtcgtgttaaac
cgatcttcggaggatgtccctcttaccatcagtgatcctgacctgggcttcctggagacc
gtgtcacctggctactccattcacacttacctgtggcgtcgccagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system