KEGG   Mus musculus (mouse): 14633Help
Entry
14633             CDS       T01002                                 

Gene name
Gli2, AW546128
Definition
GLI-Kruppel family member GLI2
Orthology
K16798  
zinc finger protein GLI2
Organism
mmu  Mus musculus (mouse)
Pathway
Hedgehog signaling pathway
Hippo signaling pathway
Pathways in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    14633 (Gli2)
   04390 Hippo signaling pathway
    14633 (Gli2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14633 (Gli2)
   05217 Basal cell carcinoma
    14633 (Gli2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    14633 (Gli2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 E2-E4; 1 52.17 cM
AA seq 1544 aa AA seqDB search
METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGVPQQLLPAFHAPLPI
DMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYVNP
HMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQMTLMA
SHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDASLD
LQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQQR
GLGSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLSSSSSNCLNDANQNKQNSESAVS
STVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETNCH
WADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGE
KPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN
EKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDNEASA
EPGGRGPEESVEASSTSHTVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNN
DSGMEMPGTGPGSLGDLTALADTCPGADTSALAAPSTGGLQLRKHMSTVHRFEQLKREKL
KSLKDSCSWAGPAPHTRNTKLPPLPVNGSVLENFNNTGGGGPAGLLPSQRLPELTEVTML
SQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSYDPIS
TDASRRSSEASQCSGGGPGLLNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLRTRLA
LLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGYAGAAPAFPHEGPNSSTRRASDPVR
RPDPLILPRVQRFHSTHNMNPGSLPPCADRRGLHVQSHPSVDSNLTRNAYSPRPPSINEN
VVMEAVAAGVDGPGLECDLGLVEDELVLPDDVVQYIKAHTGGTLDDGIRQGYPTEGTGFP
ENSKLPSPGLQGHRRLAAADSNMGPSAPGLGGCQLSYSPSSNLNKSNMPVQWNEVSSGTV
DALPTQVKPPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRGAPSAS
RGSYTQQPRQPAAGSQCLGMSAAMSPQASYSQAHPQLSPNIVSGSLNQFSPSCSNMAAKP
SHLGLPQQMEVVPNATIMNGHQREHGVPNSSLAAVSQPHPVLSYPQQDSYQQGSNLLSSH
QPGFMESQQNAGFGLMQPRPPLEPNTASRHRGVRSGQQQLYARTTGQAMVTSANQETAEA
MPKGPAGTMVSLAPQPSQDTGRAQDQNTLYYYGQIHMYEQNGGCPAVQPQPPQPQACSDS
IQPEPLPSPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQNSS
RLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atggagacttctgccccagcccctgcactggagaagaaagaagccaagagtggtctcttg
gaggacagcagcttccccgacccagggaaaaaggcctgtcctctggcggtggccgcagct
gtagccgcccacggagttcctcagcagctcctgccggctttccacgcgcctttgccgatt
gacatgagacaccaggagggaaggtaccattatgaccctcactctgtccacagtgtacac
gggcctcccaccctaagtggcagccctgtcatctcagatatctccttgatacgactttct
ccacaccctgctggccctggagagtcacccttcagcgcccaccacccctacgtgaacccc
catatggagcactacctccggtctgtgcacagcagccccacactctcaatgatctctgcc
gccaggggcctcagccctgctgatgtggcccacgaacatctgaaagagaggggactcttt
agcctcgcagccccaggcaccaacccttcagactattaccaccagatgaccctcatggca
agccaccccaccccttatggggaccttctaatgcagagcgggggtgctgctagcgcaccc
catctccatgactacctcaaccctgtggatgcatcacgattctctagtccacgtgtgacc
ccacgactgagccgcaagcgggctctgtccatctccccgctctcagatgccagcctcgac
ctacaacgcatgattcggacctctcccaactcgctggtagcttacatcaacaactccagg
agcagctcagcagccagtggctcttatggacatctgtctgctggtgccctcagcccagcc
ttcacttttccccaccccatcaatcctgtggcctaccagcagatcctgagccagcagcgg
ggcctgggctcagcctttggacacacaccacccctgatccagccttcacccaccttcttg
gcccagcagcccatgactctcacctccatcagcaccatgcctacccaactcagcagcagt
agcagcaactgtctaaatgatgccaaccagaacaagcagaacagcgagtcagctgtgagc
agcaccgtgaaccccatcaccattcataagcggagcaaggtcaagactgaggctgagggc
ctgcgtccagcatccccgcttggactgacacaggagcagctggccgatctcaaggaagac
ctggacagggatgactgtaagcaggaggccgaggtggtcatctacgagaccaactgccac
tgggcagactgcaccaaggagtatgacacacaggagcagctggtgcatcatatcaacaat
gaacacatccacggggagaagaaggagttcgtgtgccgctggcaggcctgcacgagagag
cagaagcccttcaaggcccagtacatgctggttgttcacatgcgcagacacacgggtgag
aagccacacaagtgcacgttcgaaggctgttccaaggcctactctcgcctggagaacctg
aagacacacctgcgttcacacacaggagagaagccatatgtgtgtgaacacgaaggctgt
aacaaagccttctccaatgcctcagaccgcgccaagcaccagaaccgcactcactccaat
gagaaaccctacatctgcaagatcccaggctgcaccaagaggtacacagaccccagctca
ctccgcaagcatgtgaagactgtccatgggccagacgcccatgtcaccaagaaacagcgt
aatgatgtgcatgtccgtgctccactgctcaaggagaatggggataatgaggccagcgcc
gagccaggtggccggggacctgaggagagtgtggaggccagtagcaccagccacactgtg
gaggactgcctacatatcaaagccatcaagacagagagctccgggctttgtcagtccagc
cccggggcccagtcatcctgcagcagcgagccctctcccctgggcagtgcccccaacaat
gacagtggcatggagatgccggggacagggcctgggagtctgggagacctgacagcactg
gctgacacgtgtccaggagctgacacctcagccctggctgcaccctccactggtggcctg
cagctgcgcaaacacatgagcaccgtgcatcgctttgagcagctgaagagagagaagctc
aagtcactgaaggattcctgctcgtgggccggcccagctccacacacccgcaacaccaag
ctgcctccccttccagtcaatggttctgtcctggaaaacttcaacaatacagggggcggt
ggaccggcaggactgctgcccagccagcggctaccagagctgaccgaagtgacgatgctg
agccagctgcaggaacgaagagacagctccaccagcaccatgagctcggcctacactgtg
agccgccgctcctctggcatctccccatacttctctagccgtcgctccagcgaggcttcg
cctctcggtggcctacgcccgcacaacgccagctcagcagactcctatgaccccatctcc
acagatgcctctcggcgctccagtgaagccagccagtgcagtggcggtggcccagggctg
ctcaacctcacacctgcgcagcagtacaacctgcgtgccaagtacgcagcggccacaggt
ggaccaccgcccacgccactgccgggcctcgatcgtgtaagccttcgtacccgcctggcc
ttgctggatgctcctgagcgtgcacttcctggtgcctgcccacatccactggggccacgg
cgtggcagcgatgggcctacctatagccatggtcatggccatggctacgcaggtgcggct
ccagcattcccccacgaggggccaaacagcagcacacggcgggccagcgaccctgtgcgg
cgccctgacccccttattctgcctcgagtgcaacgtttccacagtacccacaacatgaat
ccaggttcactgccaccctgcgctgatcggcgtggcctgcacgtacagagccaccccagc
gtagacagcaacctgacccgcaacgcctactctcccagaccccctagcatcaatgagaac
gtggtgatggaggccgtggctgctggggtagacggcccagggctagagtgcgacctgggg
ctggtggaggatgagctggtgctgccagatgatgtggtacagtacatcaaggctcacacc
ggtggtaccttggatgacggcattcggcaggggtatcccacagaaggtactggcttcccc
gagaactctaagctgcccagtcctgggctacaaggccaccgcaggctagcagctgccgac
tccaacatgggtccttctgctcctggactcgggggctgccagctgagctacagcccctcc
tccaacctcaacaagagcaacatgcctgtgcagtggaatgaggtgagttctggcaccgtg
gatgccctgcctacccaggtgaagccacctcctttccctcacagcaacctggctgtggtc
caacagaagccagcctttggccagtatccaggatataatccacaatccgtgcagagcagc
tccggaggtctagacagcacccagccgcacctacagcttcgaggagccccctctgcatca
agagggagctacacgcaacagcctcgacagccagctgcaggcagtcagtgcctgggtatg
agtgcggccatgagcccgcaggccagctacagccaagcccacccccagctgagcccaaac
attgtcagcggatctctgaaccagttttctccctcctgcagcaatatggcagccaagccc
agccacctgggactccctcagcaaatggaagttgtccccaatgccaccatcatgaatggc
catcaacgggagcacggggtccccaattcatccctggctgcggtgtcacaacctcaccca
gtcctgagctatccccagcaggacagctaccaacagggctccaaccttctgtcatcccat
cagcctggcttcatggagtcccagcagaacgcgggctttggtctcatgcagcctcggcca
cccctggaacccaacacggccagccgtcaccgtggagtacgttctgggcaacagcagttg
tatgccaggaccactggccaagccatggtcacatcagccaaccaagagacagcagaagct
atgcccaagggaccagcagggaccatggtatccctagctcctcagccatctcaggacaca
gggcgggcacaagatcagaacacgctatactactatggccagatccacatgtatgaacag
aatggaggctgcccagccgtgcagccccagccgccacaaccacaagcttgctcagacagt
atccagcctgagcctttgccttcaccgggagtcaaccaggtgtctagcaccgtggactcc
cagctcctggagcccccccagattgactttgatgccatcatggatgatggtgatcactcg
agtttgttttctggtgcactgagcccaacccttctccacaatctctcccagaattcctca
cgcctcaccacaccccggaattccttgacactgccctccatccctgcgggcatcagcaac
atggccgtgggcgacatgagttccatgctcaccagcctggctgaagagagcaagttttta
aacatgatgacctaa

DBGET integrated database retrieval system