KEGG   Mus musculus (mouse): 14810Help
Entry
14810             CDS       T01002                                 

Gene name
Grin1, GluN1, GluRdelta1, GluRzeta1, M100174, NMD-R1, NMDAR1, NR1, Nmdar, Rgsc174
Definition
(RefSeq) glutamate receptor, ionotropic, NMDA1 (zeta 1)
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu05010  Alzheimer's disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington's disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05033  Nicotine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14810 (Grin1)
   04015 Rap1 signaling pathway
    14810 (Grin1)
   04020 Calcium signaling pathway
    14810 (Grin1)
   04024 cAMP signaling pathway
    14810 (Grin1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14810 (Grin1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    14810 (Grin1)
   04720 Long-term potentiation
    14810 (Grin1)
  Environmental adaptation
   04713 Circadian entrainment
    14810 (Grin1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14810 (Grin1)
   05014 Amyotrophic lateral sclerosis (ALS)
    14810 (Grin1)
   05016 Huntington's disease
    14810 (Grin1)
  Substance dependence
   05030 Cocaine addiction
    14810 (Grin1)
   05031 Amphetamine addiction
    14810 (Grin1)
   05033 Nicotine addiction
    14810 (Grin1)
   05034 Alcoholism
    14810 (Grin1)
Ion channels [BR:mmu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   14810 (Grin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Peripla_BP_6 Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 14810
NCBI-ProteinID: NP_032195
MGI: 95819
Ensembl: ENSMUSG00000026959
Vega: OTTMUSG00000011933
UniProt: P35438
Position
2 A3; 2 17.14 cM
AA seq 938 aa AA seqDB search
MSTMHLLTFALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEARDLEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCVDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatgcacctgctgacattcgccctgcttttctcctgctccttcgcccgcgct
gcctgcgaccccaagattgtcaacatcggcgcggtgctgagcacgcgcaagcacgagcag
atgttccgcgaggcagtaaaccaggccaataagcgacacggctcttggaagatacagctc
aacgccacttctgtcacccacaagcccaacgccatacagatggccctgtcagtgtgtgag
gacctcatctctagccaggtctacgctatcctagttagtcacccgcctactcccaacgac
cacttcactcccacccctgtctcctacacagctggcttctacagaatccccgtcctgggg
ctgactacccgaatgtccatctactctgacaagagcatccacctgagcttccttcgcacc
gtaccaccctactcccaccagtccagcgtctggtttgagatgatgcgcgtctacaactgg
aaccatatcatcctgctggtcagcgatgaccacgagggccgggcagcgcagaagcgcctg
gagacgttgctggaggagcgtgagtccaaggcagagaaggtgctgcagtttgacccagga
accaagaatgtgacggctctgctgatggaagcccgggacctggaagcccgggtcatcatc
ctttctgcaagcgaggacgacgctgccaccgtataccgcgcagccgcgatgctgaacatg
actggctctgggtacgtgtggctcgtcggggagcgcgagatctctgggaatgccctgcgc
tacgctcctgacggcatcatcggacttcagctaatcaacggcaagaacgagtcggcccac
atcagtgacgctgtgggcgtggtggcacaggcagtccacgagctcctagaaaaggagaac
atcactgatccaccgcggggttgcgtgggcaacaccaacatctggaagacaggaccactg
ttcaagagggtgctgatgtcttccaagtatgcagatggagtgactggccgtgtggaattc
aatgaggatggggaccggaagtttgccaactatagtatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggtacccatgtcatcccaaatgacaggaagatcatc
tggccaggaggagagacagagaagcctcgaggataccagatgtccaccagactaaagata
gtgacaatccaccaagaacccttcgtgtatgtcaagcccacaatgagtgatggcacatgc
aaagaggagttcacagtcaatggtgaccctgtcaagaaggtgatctgtacggggcctaat
gacacatccccaggaagcccacgtcacacagtgccccagtgctgttatggcttctgcgtt
gacctgctcatcaagctggcacggaccatgaattttacctacgaggtgcaccttgtggca
gatggcaagtttggcacacaggagcgggtaaacaacagcaacaaaaaggagtggaacgga
atgatgggagagctgctcagtggtcaagcagacatgatcgtggctccactgaccattaac
aatgagcgtgcgcagtacatagagttctccaagcccttcaagtaccagggcctgaccatt
ctggtcaagaaggagatccctcggagcacactggactcattcatgcagccctttcagagc
acactgtggctgctggtggggctgtcagttcatgtggtggccgtgatgctgtacctgctg
gaccgcttcagtccctttggccgatttaaggtgaacagcgaggaggaggaggaggatgca
ctgaccctgtcctctgccatgtggttttcctggggcgtcctgctcaactctggcattggg
gaaggtgccccccggagtttctctgctcgtatcctaggcatggtgtgggctggttttgcc
atgatcatcgtggcttcctacactgccaacctggcagccttcctggtgctggataggcct
gaggagcgcatcacaggcatcaatgaccccaggctcagaaacccctcagacaagttcatc
tatgcaactgtaaaacagagctctgtggatatctacttccggaggcaggtggagttgagc
accatgtaccggcacatggagaagcacaattatgagagtgcagctgaggccatccaggct
gtgcgggacaacaagctccatgccttcatctgggactcagctgtgctggagtttgaggct
tcacagaagtgcgatctggtgaccacgggtgagctgttcttccgctccggctttggcatc
ggcatgcgcaaggacagcccctggaagcaaaatgtgtccctgtccatactcaagtcccat
gagaatggcttcatggaagacctggataagacatgggttcggtatcaagaatgtgactcc
cgcagcaatgcccctgccaccctcacttttgagaacatggcaggggtcttcatgctggtg
gctggaggcatcgtagctgggatcttcctcattttcatcgagatcgcctacaagcgacac
aaggatgcccgtaggaagcagatgcagctggcttttgcagccgtgaacgtgtggaggaag
aacctgcaggatagaaagagtggtagagcagagcccgaccctaaaaagaaagccacattt
agggctatcacctccaccctggcctccagcttcaagagacgtaggtcctccaaagacacg
agcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcgacgc
gctattgagagggaggagggccagctgcagctgtgttcccgtcatagggagagctga

DBGET integrated database retrieval system