KEGG   Mus musculus (mouse): 15212Help
Entry
15212             CDS       T01002                                 

Gene name
Hexb
Definition
(RefSeq) hexosaminidase B
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu00531  Glycosaminoglycan degradation
mmu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mmu00604  Glycosphingolipid biosynthesis - ganglio series
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    15212 (Hexb)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    15212 (Hexb)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    15212 (Hexb)
   00604 Glycosphingolipid biosynthesis - ganglio series
    15212 (Hexb)
   00511 Other glycan degradation
    15212 (Hexb)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    15212 (Hexb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     15212 (Hexb)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   15212 (Hexb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 15212
NCBI-ProteinID: NP_034552
MGI: 96074
Ensembl: ENSMUSG00000021665
UniProt: P20060 Q3TXR9
Position
13 D1; 13 50.66 cM
AA seq 536 aa AA seqDB search
MPQSPRSAPGLLLLQALVSLVSLALVAPARLQPALWPFPRSVQMFPRLLYISAEDFSIDH
SPNSTAGPSCSLLQEAFRRYYNYVFGFYKRHHGPARFRAEPQLQKLLVSITLESECESFP
SLSSDETYSLLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFP
HRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYS
LSHVYTPNDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGP
VDPTVNTTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFR
RLESFYIKKILEIISSLKKNSIVWQEVFDDKVELQPGTVVEVWKSEHYSYELKQVTGSGF
PAILSAPWYLDLISYGQDWKNYYKVEPLNFEGSEKQKQLVIGGEACLWGEFVDATNLTPR
LWPRASAVGERLWSPKTVTDLENAYKRLAVHRCRMVSRGIAAQPLYTGYCNYENKI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtccccgcgtagcgcccccgggctgctgctgctgcaggcgctggtgtcgcta
gtgtcgctggccctagtggccccggcccgactgcaacctgcgctatggcccttcccgcgc
tcggtgcagatgttcccgcggctgttgtacatctccgcggaggacttcagcatcgaccac
agtcccaattccacagcgggcccttcctgctcgctgctacaggaggcgtttcggcgatat
tacaactatgtttttggtttctacaagagacatcatggccctgctagatttcgagctgag
ccacagttgcagaagctcctggtctccattaccctcgagtcagagtgcgagtccttccct
agtctgtcttcagatgaaacctattctctgcttgtacaagaaccagtagccgtcctcaag
gccaacagcgtttggggagcgttacgaggtttagagacgtttagccagttagtttaccaa
gactctttcgggactttcaccatcaatgaatccagtatagctgattctccaagattccct
catagaggaattttaattgatacatctagacacttcctgcctgtgaagacaattttaaaa
actctggatgccatggcttttaataagtttaatgttcttcactggcacatagtggacgac
cagtctttcccttatcagagtaccacttttcctgagctaagcaataagggaagctactct
ttgtctcatgtctatacaccaaacgatgtccggatggtgctggagtacgcccggctccga
gggattcgagtcataccagaatttgatacccctggccatacacagtcttggggcaaagga
cagaaaaaccttctaactccatgttacaatcaaaaaactaaaactcaagtgtttgggcct
gtagacccaactgtaaacacaacgtatgcattctttaacacatttttcaaagaaatcagc
agtgtgtttccagatcagttcatccacttgggaggagatgaagtagaatttcaatgttgg
gcatcaaatccaaacatccaaggtttcatgaagagaaagggctttggcagcgattttaga
agactagaatccttttatattaaaaagattttggaaattatttcatccttaaagaagaac
tccattgtttggcaagaagtttttgatgataaggtggagcttcagccgggcacagtagtc
gaagtgtggaagagtgagcattattcatatgagctaaagcaagtcacaggctctggcttc
cctgccatcctttctgctccttggtacttagacctgatcagctatgggcaagactggaaa
aactactacaaagttgagccccttaattttgaaggctctgagaagcagaaacaacttgtt
attggtggagaagcttgcctgtggggagaatttgtggatgcaactaaccttactccaaga
ttatggcctcgagcaagcgctgttggtgagagactctggagccctaaaactgtcactgac
ctagaaaatgcctacaaacgactggccgtgcaccgctgcagaatggtcagccgtggaata
gctgcacaacctctctatactggatactgtaactatgagaataaaatatag

DBGET integrated database retrieval system