KEGG   Mus musculus (mouse): 15370Help
Entry
15370             CDS       T01002                                 

Gene name
Nr4a1, GFRP1, Gfrp, Hbr-1, Hbr1, Hmr, N10, NGFI-B, NGFIB, NP10, TIS1, TR3, nur77
Definition
(RefSeq) nuclear receptor subfamily 4, group A, member 1
  KO
K04465  
nuclear receptor subfamily 4 group A member 1
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    15370 (Nr4a1)
   04151 PI3K-Akt signaling pathway
    15370 (Nr4a1)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    15370 (Nr4a1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 nerve growth factor IB-like
    15370 (Nr4a1)
Nuclear receptors [BR:mmu03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   15370 (Nr4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15; 15 F
AA seq 601 aa AA seqDB search
MPCIQAQYGTPATSPGPRDHLTGDPLALEFGKPTMDLASPETAPAAPATLPSFSTFMDGY
TGEFDTFLYQLPGTTQPCSSACSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSG
PLDETLSSSGSEYYGSPCSAPSPSTPNFQPSQLSPWDGSFGHFSPSQTYEGLWAWTEQLP
KASSGPPPPPTFFSFSPPTGPSPSLAQSSLKLFPPPATHQLGEGESYSMPAAFPGLAPTS
PNRDTSGILDAPVTSTKSRSGASGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQK
SAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPP
DASPTNLLTSLIRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVI
RKWAEKIPGFIELCPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHQLQCAR
GFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKE
HMATVAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLS
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtattcaagctcaatatggaacaccagcaacgagcccaggaccgcgtgaccac
ctgaccggtgatcccctggcccttgagttcggcaagcctaccatggacctggccagcccc
gagacagcacctgccgcacctgctacactgcccagcttcagcaccttcatggacgggtac
accggagagtttgacaccttcctctaccagctgccggggacgacccagccgtgctcctca
gcttgttcctctgcctcctccacgtcttcttcctcatcctcggccacctcccccgcttcg
gcgtccttcaagtttgaggacttccaggtgtacggctgctacccgggcaccctgagcggc
ccattagatgagaccctatcctccagcggctctgagtactatggcagtccctgctcagcc
ccctcgccatctacacccaacttccagccgtcccagctttctccctgggacggctcattt
ggccacttctccccgagccagacttatgaaggcctctgggcatggacagagcagttgcct
aaggcttcttcagggcctccgccacctccaaccttcttctccttcagtcctcccactggc
cccagccccagcctggcccagagttctctgaaattgttcccaccaccagccacccaccag
cttggggagggggagagctattccatgccagcagctttccccggcttggcacccacctct
ccgaaccgtgacacttccggcattctggacgcacccgtgacctccaccaagtcccggagc
ggggcttcaggtggcagcgagggccgctgtgcagtctgtggtgacaatgcttcgtgtcag
cactatggggtccgcacctgtgagggctgcaagggcttcttcaagcgcacagtacagaaa
agcgccaagtacatctgcctggcaaacaaggattgccctgtggacaagaggcggcggaac
cgctgccagttctgccgcttccagaagtgcctggctgtgggcatggtgaaggaagttgta
cggacagacagcctaaaagggcggcggggccggctaccttcaaaacccaagcagcctcca
gatgcctcccctaccaatcttctcacttccctcatccgggcacacttggactccgggcct
agcactgccaaattggactattccaagttccaggaactggtgctgccccgcttcgggaag
gaagatgccggtgacgtgcaacaattttatgacttgctctctggttccctggacgttatc
cgaaagtgggcagaaaaaatccctggcttcattgagctttgcccaggagaccaagacctg
ttgctagagtctgccttcctggaactcttcatcctccgcctggcataccgatctaaaccc
ggtgaggggaagctcatcttctgctcaggcctggtactacaccagctgcagtgtgcccgt
ggctttggtgattggattgacaacatcctggccttctcacggtccctgcacagcttgggt
gttgatgttcccgcctttgcctgcctgtccgctctggtcctcatcactgatcgacacggg
ctccaggaccctcgtcgggtggaagagctgcagaatcgcattgctagctgtctgaaggag
cacatggctaccgtggcaggagacccacagccggccagctgcctgtcacgtctgctgggc
aaactgcctgagcttcggaccctgtgcactcaaggcctgcagcgcatcttttgcctcaag
ttggaggacttggtaccccctccacctattgtggacaagatctttatggacacattgtct
ttctga

DBGET integrated database retrieval system