KEGG   Mus musculus (mouse): 15519Help
Entry
15519             CDS       T01002                                 

Gene name
Hsp90aa1, 86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4
Definition
(RefSeq) heat shock protein 90, alpha (cytosolic), class A member 1
  KO
K04079  
molecular chaperone HtpG
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Antigen processing and presentation
NOD-like receptor signaling pathway
IL-17 signaling pathway
Th17 cell differentiation
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15519 (Hsp90aa1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    15519 (Hsp90aa1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    15519 (Hsp90aa1)
   04612 Antigen processing and presentation
    15519 (Hsp90aa1)
   04659 Th17 cell differentiation
    15519 (Hsp90aa1)
   04657 IL-17 signaling pathway
    15519 (Hsp90aa1)
  Endocrine system
   04915 Estrogen signaling pathway
    15519 (Hsp90aa1)
   04914 Progesterone-mediated oocyte maturation
    15519 (Hsp90aa1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    15519 (Hsp90aa1)
   05215 Prostate cancer
    15519 (Hsp90aa1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    15519 (Hsp90aa1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15519 (Hsp90aa1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   15519 (Hsp90aa1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15519 (Hsp90aa1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    15519 (Hsp90aa1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15519 (Hsp90aa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12 F1; 12 60.75 cM
AA seq 733 aa AA seqDB search
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaggaggaggtcgagaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaataccttctactcgaac
aaagagatctttctgagggagctcatctccaattcatcggacgctctggataaaatccgt
tacgagagcctgacggaccccagtaaactggactcggggaaggagctgcacatcaatctc
attcccagcaaacaggaccgaaccctgaccattgtggataccgggattggaatgaccaag
gccgacttgatcaataaccttggcaccattgccaagtcgggcaccaaagccttcatggag
gctttgcaggctggtgcagatatctctatgattggccagtttggtgttggtttttactct
gcctatttggttgctgagaaagtgactgtcatcacgaagcataacgacgatgagcagtat
gcctgggagtcctcagctgggggatccttcacagtgaggactgacacaggtgaaccaatg
ggtcgtggaacaaaggttatcttgcatctgaaagaagaccaaacagagtatttggaggaa
aggagaataaaggagatcgtgaagaagcattctcagttcattggctatcccattactctc
tttgtggagaaggaacgagataaggaagtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtctgatgataaacctgaaatagaagat
gttggctctgatgaagaagaggaggagaagaaggatggtgacaagaagaaaaagaagaag
ataaaggaaaagtacattgatcaagaagaactcaacaaaacaaagccgatttggacgaga
aatcctgatgacatcactaatgaggaatatggagagttctacaagagcttaactaacgat
tgggaagaacacttggcagtaaagcatttttctgttgaaggacaattagaattccgggcc
cttctttttgtcccaagacgcgctccttttgatctgtttgaaaacagaaagaaaaagaac
aacatcaagttgtatgttcgcagagtttttatcatggataactgtgaggaattaatccct
gagtatctgaatttcattagaggggtagtggattctgaggatctccctctaaatatttcc
cgtgaaatgctgcaacaaagtaaaattctgaaagttatcagaaagaatttggtcaagaaa
tgcttagaactatttactgaactagcagaagataaagagaactacaaaaagttttatgag
cagttctcaaaaaatataaagcttggaattcacgaggactctcagaatcggaagaagctt
tcagagctgttgcggtactacacatctgcttctggggacgagatggtttctctgaaggac
tactgtaccagaatgaaggaaaaccagaagcacatctattttatcacaggtgagaccaag
gaccaggttgctaactccgcctttgtggaacgtctccgaaagcatggcttagaagtaatt
tatatgattgagcccattgatgagtattgtgtgcaacagctgaaggaatttgagggcaag
accttggtgtctgttaccaaagaaggactggaacttccagaagatgaagaggaaaagaag
aaacaggaagagaaaaagacaaaatttgagaacctctgcaaaattatgaaagatattttg
gagaagaaggttgaaaaggtggttgtgtcaaaccgactggtgacatccccgtgctgtatt
gtcacaagcacatatgggtggacagcaaacatggagagaatcatgaaagctcaagccctc
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaatcctgat
cactccattattgaaaccttaaggcaaaaggcagaggctgacaagaatgacaaatctgtg
aaggatctggtcatcttgctgtatgaaactgcactcctatcttctggcttcagtctggaa
gatccccagacccatgctaacaggatctacaggatgatcaagcttggtctaggtattgat
gaggatgatcctactgtggatgacaccagtgctgctgtaactgaagaaatgcctcccctg
gaaggagatgacgacacatcacgcatggaagaagtagactaa

DBGET integrated database retrieval system