KEGG   Mus musculus (mouse): 15551Help
Entry
15551             CDS       T01002                                 

Gene name
Htr1b
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 1B
  KO
K04153  
5-hydroxytryptamine receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    15551 (Htr1b)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15551 (Htr1b)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    15551 (Htr1b)
  Sensory system
   04742 Taste transduction
    15551 (Htr1b)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    15551 (Htr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 E1; 9 44.61 cM
AA seq 386 aa AA seqDB search
MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCAG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcagggtattcagtgcgccccgccgcctcccgccgcctcccagacaggggta
cctctcaccaacctctcccacaactgcagcgccgacggctacatttaccaggactccatc
gccctgccctggaaagtcctgctggttgctttgttggcgctcatcaccttggccaccacg
ctctccaacgcctttgtaatcgctacggtgtatcggacccggaagctacacaccccggct
aactacctgatcgcctctctggcagtcactgacctgctcgtgtccatcctggtgatgccc
atcagcaccatgtacacggtcactggacgctggacactaggccaggtggtctgcgacttc
tggctgtcgtcggatatcacctgttgcactgcttccatcatgcatctctgtgtcatcgcc
ctggaccgctactgggccatcaccgatgcggtggagtattctgctaaaaggactcccaaa
agggcggccatcatgatcgtgctggtgtgggtcttctccatctctatttcgttgccaccc
ttcttctggcgtcaagccaaagcagaggaggagatgctggactgctttgtgaacaccgac
cacgtcctctacacggtctactccacggtgggcgctttctatttacccaccctgctcctc
atcgccctctatggccgcatctatgtggaagcccgctctcggattttgaaacagacaccc
aacaagaccggcaagcgcttgacccgagcccagttgataacagactccccgggatccaca
tcctcggtcacctccattaactcccgggctccggacgtgcccagtgagtccgggtctcct
gtgtacgtgaaccaagtcaaagtgcgagtctcagacgccctgctggaaaagaagaaactc
atggccgctagggagcgcaaagccaccaagaccctagggatcattttaggagcatttatt
gtgtgttggctgcccttcttcatcatctccctggtgatgcctatctgtaaggatgcctgc
tggtttcacatggccatttttgacttcttcaattggttaggctatcttaactccctcatc
aaccccatcatctacaccatgtccaatgaggacttcaaacaagcgttccacaaactgata
cgctttaagtgcgcaggttga

DBGET integrated database retrieval system