KEGG   Mus musculus (mouse): 15903Help
Entry
15903             CDS       T01002                                 

Gene name
Id3, Hlh462, Idb3, bHLHb25
Definition
inhibitor of DNA binding 3
Orthology
K17694  
DNA-binding protein inhibitor ID3
Organism
mmu  Mus musculus (mouse)
Pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    15903 (Id3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    15903 (Id3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
4 D3; 4 68.34 cM
AA seq 119 aa AA seqDB search
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgagcccggtgcgcggctgctacgaggcggtgtgctgcctgtcggaacgt
agcctggccattgcgcgaggccgcggtaagagcccgtcgaccgaggagcctcttagcctc
ttggacgacatgaaccactgctactcgcgcctgcgggaactggtgccgggagtcccgcga
ggcactcagcttagccaggtggaaatcctgcagcgtgtcatagactacatcctcgacctt
caggtggtcctggcagagccggcgcctggacccccggacggtccgcatctcccgatccag
acagctgagctcactccggaacttgtgatctccaaggacaagaggagcttttgccactga

  All links  
No link information was found.   
DBGET integrated database retrieval system