KEGG   Mus musculus (mouse): 16175Help
Entry
16175             CDS       T01002                                 

Gene name
Il1a, Il-1a
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  
interleukin 1 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Osteoclast differentiation
Hematopoietic cell lineage
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Type I diabetes mellitus
Prion diseases
Salmonella infection
Pertussis
Leishmaniasis
Tuberculosis
Measles
Influenza A
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    16175 (Il1a)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16175 (Il1a)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    16175 (Il1a)
  Development
   04380 Osteoclast differentiation
    16175 (Il1a)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    16175 (Il1a)
   05321 Inflammatiory bowel disease (IBD)
    16175 (Il1a)
   05332 Graft-versus-host disease
    16175 (Il1a)
  Neurodegenerative diseases
   05020 Prion diseases
    16175 (Il1a)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    16175 (Il1a)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16175 (Il1a)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16175 (Il1a)
  Infectious diseases
   05132 Salmonella infection
    16175 (Il1a)
   05133 Pertussis
    16175 (Il1a)
   05152 Tuberculosis
    16175 (Il1a)
   05162 Measles
    16175 (Il1a)
   05164 Influenza A
    16175 (Il1a)
   05140 Leishmaniasis
    16175 (Il1a)
Cytokines [BR:mmu04052]
 IL-1 family
  16175 (Il1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 62.9 cM; 2 F
AA seq 270 aa AA seqDB search
MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETS
KMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEETIQPRSAPYTY
QSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDD
SKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSA
AYPELFIATKEQSRVHLARGLPSMTDFQIS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttcctgacttgtttgaagacctaaagaactgttacagtgaaaacgaagac
tacagttctgccattgaccatctctctctgaatcagaaatccttctatgatgcaagctat
ggctcacttcatgagacttgcacagatcagtttgtatctctgagaacctctgaaacgtca
aagatgtccaacttcaccttcaaggagagccgggtgacagtatcagcaacgtcaagcaac
gggaagattctgaagaagagacggctgagtttcagtgagaccttcactgaagatgacctg
cagtccataacccatgatctggaagagaccatccaacccagatcagcaccttacacctac
cagagtgatttgagatacaaactgatgaagctcgtcaggcagaagtttgtcatgaatgat
tccctcaaccaaactatatatcaggatgtggacaaacactatctcagcaccacttggtta
aatgacctgcaacaggaagtaaaatttgacatgtatgcctactcgtcgggaggagacgac
tctaaatatcctgttactctaaaaatctcagattcacaactgttcgtgagcgctcaagga
gaagaccagcccgtgttgctgaaggagttgccagaaacaccaaaactcatcacaggtagt
gagaccgacctcattttcttctggaaaagtatcaactctaagaactacttcacatcagct
gcttatccagagctgtttattgccaccaaagaacaaagtcgggtgcacctggcacgggga
ctgccctctatgacagacttccagatatcataa

DBGET integrated database retrieval system