KEGG   Mus musculus (mouse): 16533Help
Entry
16533             CDS       T01002                                 

Gene name
Kcnmb1, BKbeta1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    16533 (Kcnmb1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    16533 (Kcnmb1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    16533 (Kcnmb1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   16533 (Kcnmb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A4; 11
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNI
KDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADV
KKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLILIAMVKL
NRSLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcgcggagagacacgagccctctgcctggga
gtggcaatggtagtgtgtgctgccatcacctactacgtcctgggtacaactgtgctgccc
ctctaccagaaaagtgtgtggacccaggaatccatatgtcacttgattgaaactaatatc
aaggaccaggaagagctggagggcaagaaggtgccccagtacccatgcctttgggtcaat
gtatcagctgtgggcagatgggccatgctgtatcacacggaagacactcgggatcaaaac
caacagtgctcctatatccccaggaacctggacaactaccagacagccttggcagatgtg
aagaaggtcagagccaatttctataagcaccatgaattctattgcctttctgcacctcaa
gtcaacgagaccagcgtcgtgtaccagcgcctctacgggccccaagtcctcctcttctcc
ttcttctggcccaccttcctgctgaccgggggtcttattcttattgccatggtgaagctc
aacaggtccctatccatcttggcggctcagaagtag

DBGET integrated database retrieval system