KEGG   Mus musculus (mouse): 16534Help
Entry
16534             CDS       T01002                                 

Gene name
Kcnn4, IK1, IKCA1, KCA4, KCa3.1, SK4, SKCas, mIKCa1
Definition
(RefSeq) potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
  KO
K04945  
potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
mmu  Mus musculus (mouse)
Pathway
Insulin secretion
Salivary secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    16534 (Kcnn4)
  Digestive system
   04970 Salivary secretion
    16534 (Kcnn4)
   04974 Protein digestion and absorption
    16534 (Kcnn4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNN, KCa2-3.x (Small conductance)
   16534 (Kcnn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 425 aa AA seqDB search
MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAEMLWFLGCKWVLYLLL
VKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQVAQILLELLVCGVHPV
PLRSPHCALAGEATDAQPWPGFLGEGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSI
GALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLTDTLW
LIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM
MDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLR
EQVNSMVDISKMHMILCDLQLGLSSSHRALEKRIDGLAGKLDALTELLGTALQQQQLPEP
SQEAT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggagctggtgactggcctgggggccctgagacggagaaagcgcctgctggag
caggagaagagggtggccggctgggcgttggtgctggcgggaactggcatcggactcatg
gttctgcacgctgagatgttgtggttcctgggctgcaagtgggtgctgtacctgctcctg
gttaagtgtttgatcaccctgtccactgccttcctcctttgtcttattgtggtcttccat
gccaaggaggtccagctgttcatgactgacaacgggctccgggactggcgcgtggcgctg
acccggcggcaggtggcgcagatcctgctggagctgttggtgtgcggggtgcacccggtg
cccctacggagcccgcactgcgccctggcgggggaggccaccgacgcgcagccctggccg
ggtttcctgggcgaaggcgaggcgttgctgtccctggccatgctcctgcgtctctacctg
gtgccccgcgcggtgctgctgcgcagcggggtcctgctcaacgcgtcctaccgcagcatc
ggggcgctcaaccaagtccgcttccgccactggttcgtggccaagctgtacatgaacacg
cacccgggtcgcctgctgctgggcctcacgctgggtctctggctcaccacagcttgggtg
ctgtctgtggctgagaggcaggctgtcaatgccacggggcacctcacagacacactgtgg
ctgattccgatcacattcctgaccattggctatggggacgtggtacctggcaccatgtgg
ggcaagattgtctgcctgtgcaccggagtcatgggggtctgctgcacagctctcctggtg
gctgtggtggctcggaagctggagttcaacaaggcggagaaacacgtgcacaacttcatg
atggacatccattatgccaaagagatgaaggagtcagcggcgcggctgctgcaggaagcc
tggatgtactacaagcacactcgaaggaaggactcccgggctgcccgcagacatcagcgc
aagatgctggccgccatccacacgttccgccaggtacggctgaaacaccggaagctccgg
gaacaagtgaattccatggtggacatctccaagatgcacatgatcctgtgcgacctgcag
ctgggtctcagctcctcgcaccgtgccctggagaagagaatcgacggtctggcaggaaag
ctggatgccctgacagagctgctcggcactgctctgcagcaacagcagctaccagaaccc
agtcaggaggccacatag

DBGET integrated database retrieval system