KEGG   Mus musculus (mouse): 16653Help
Entry
16653             CDS       T01002                                 

Gene name
Kras, AI929937, K-Ras, K-Ras_2, Ki-ras, Kras-2, Kras2, c-K-ras, c-Ki-ras, p21B, ras
Definition
(RefSeq) Kirsten rat sarcoma viral oncogene homolog
  KO
K07827  GTPase KRas
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05034  Alcoholism
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    16653 (Kras)
   04015 Rap1 signaling pathway
    16653 (Kras)
   04010 MAPK signaling pathway
    16653 (Kras)
   04012 ErbB signaling pathway
    16653 (Kras)
   04370 VEGF signaling pathway
    16653 (Kras)
   04371 Apelin signaling pathway
    16653 (Kras)
   04068 FoxO signaling pathway
    16653 (Kras)
   04072 Phospholipase D signaling pathway
    16653 (Kras)
   04071 Sphingolipid signaling pathway
    16653 (Kras)
   04151 PI3K-Akt signaling pathway
    16653 (Kras)
   04150 mTOR signaling pathway
    16653 (Kras)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    16653 (Kras)
   04137 Mitophagy - animal
    16653 (Kras)
  Cell growth and death
   04210 Apoptosis
    16653 (Kras)
   04218 Cellular senescence
    16653 (Kras)
  Cellular community - eukaryotes
   04540 Gap junction
    16653 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    16653 (Kras)
  Cell motility
   04810 Regulation of actin cytoskeleton
    16653 (Kras)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    16653 (Kras)
   04650 Natural killer cell mediated cytotoxicity
    16653 (Kras)
   04660 T cell receptor signaling pathway
    16653 (Kras)
   04662 B cell receptor signaling pathway
    16653 (Kras)
   04664 Fc epsilon RI signaling pathway
    16653 (Kras)
   04062 Chemokine signaling pathway
    16653 (Kras)
  Endocrine system
   04910 Insulin signaling pathway
    16653 (Kras)
   04912 GnRH signaling pathway
    16653 (Kras)
   04915 Estrogen signaling pathway
    16653 (Kras)
   04914 Progesterone-mediated oocyte maturation
    16653 (Kras)
   04917 Prolactin signaling pathway
    16653 (Kras)
   04921 Oxytocin signaling pathway
    16653 (Kras)
   04926 Relaxin signaling pathway
    16653 (Kras)
   04919 Thyroid hormone signaling pathway
    16653 (Kras)
   04916 Melanogenesis
    16653 (Kras)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16653 (Kras)
  Nervous system
   04725 Cholinergic synapse
    16653 (Kras)
   04726 Serotonergic synapse
    16653 (Kras)
   04720 Long-term potentiation
    16653 (Kras)
   04730 Long-term depression
    16653 (Kras)
   04722 Neurotrophin signaling pathway
    16653 (Kras)
  Development
   04360 Axon guidance
    16653 (Kras)
  Aging
   04211 Longevity regulating pathway - mammal
    16653 (Kras)
   04213 Longevity regulating pathway - multiple species
    16653 (Kras)
  Environmental adaptation
   04714 Thermogenesis
    16653 (Kras)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16653 (Kras)
   05230 Central carbon metabolism in cancer
    16653 (Kras)
   05231 Choline metabolism in cancer
    16653 (Kras)
   05206 MicroRNAs in cancer
    16653 (Kras)
   05205 Proteoglycans in cancer
    16653 (Kras)
   05203 Viral carcinogenesis
    16653 (Kras)
   05210 Colorectal cancer
    16653 (Kras)
   05212 Pancreatic cancer
    16653 (Kras)
   05225 Hepatocellular carcinoma
    16653 (Kras)
   05226 Gastric cancer
    16653 (Kras)
   05214 Glioma
    16653 (Kras)
   05216 Thyroid cancer
    16653 (Kras)
   05221 Acute myeloid leukemia
    16653 (Kras)
   05220 Chronic myeloid leukemia
    16653 (Kras)
   05218 Melanoma
    16653 (Kras)
   05211 Renal cell carcinoma
    16653 (Kras)
   05219 Bladder cancer
    16653 (Kras)
   05215 Prostate cancer
    16653 (Kras)
   05213 Endometrial cancer
    16653 (Kras)
   05224 Breast cancer
    16653 (Kras)
   05223 Non-small cell lung cancer
    16653 (Kras)
  Substance dependence
   05034 Alcoholism
    16653 (Kras)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    16653 (Kras)
  Infectious diseases
   05166 HTLV-I infection
    16653 (Kras)
   05161 Hepatitis B
    16653 (Kras)
   05160 Hepatitis C
    16653 (Kras)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    16653 (Kras)
   05165 Human papillomavirus infection
    16653 (Kras)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    16653 (Kras)
   01522 Endocrine resistance
    16653 (Kras)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    16653 (Kras)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    16653 (Kras)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ArgK FeoB_N G-alpha ATP_bind_1 Septin ParA CbiA AAA_25
Motif
Other DBs
NCBI-GeneID: 16653
NCBI-ProteinID: NP_067259
MGI: 96680
Ensembl: ENSMUSG00000030265
Vega: OTTMUSG00000022179
UniProt: P32883 Q5J7N1
Position
6 G3; 6 77.37 cM
AA seq 188 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SRTRCTVM
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtggttggagctggtggcgtaggcaagagcgccttgacg
atacagctaattcagaatcactttgtggatgagtatgaccctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctggtagggaataagtgtgatttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttacgggattccg
ttcattgagacctcagcaaagacaagacagggtgttgacgatgccttctatacattagtc
cgagaaattcgaaaacataaagaaaagatgagcaaagatgggaagaagaagaagaagaag
tcaaggacaaggtgtacagttatgtga

DBGET integrated database retrieval system