KEGG   Mus musculus (mouse): 16653Help
Entry
16653             CDS       T01002                                 

Gene name
Kras, AI929937, K-ras, Ki-ras, Kras-2, Kras2, p21B, ras
Definition
(RefSeq) Kirsten rat sarcoma viral oncogene homolog
  KO
K07827  
GTPase KRas
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Dorso-ventral axis formation
Axon guidance
VEGF signaling pathway
Tight junction
Gap junction
Signaling pathways regulating pluripotency of stem cells
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Alcoholism
Hepatitis C
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    16653 (Kras)
   04015 Rap1 signaling pathway
    16653 (Kras)
   04010 MAPK signaling pathway
    16653 (Kras)
   04012 ErbB signaling pathway
    16653 (Kras)
   04370 VEGF signaling pathway
    16653 (Kras)
   04068 FoxO signaling pathway
    16653 (Kras)
   04072 Phospholipase D signaling pathway
    16653 (Kras)
   04071 Sphingolipid signaling pathway
    16653 (Kras)
   04151 PI3K-Akt signaling pathway
    16653 (Kras)
   04150 mTOR signaling pathway
    16653 (Kras)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    16653 (Kras)
  Cell growth and death
   04210 Apoptosis
    16653 (Kras)
  Cellular commiunity
   04530 Tight junction
    16653 (Kras)
   04540 Gap junction
    16653 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    16653 (Kras)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    16653 (Kras)
   04660 T cell receptor signaling pathway
    16653 (Kras)
   04662 B cell receptor signaling pathway
    16653 (Kras)
   04664 Fc epsilon RI signaling pathway
    16653 (Kras)
   04062 Chemokine signaling pathway
    16653 (Kras)
  Endocrine system
   04910 Insulin signaling pathway
    16653 (Kras)
   04912 GnRH signaling pathway
    16653 (Kras)
   04915 Estrogen signaling pathway
    16653 (Kras)
   04914 Progesterone-mediated oocyte maturation
    16653 (Kras)
   04917 Prolactin signaling pathway
    16653 (Kras)
   04921 Oxytocin signaling pathway
    16653 (Kras)
   04919 Thyroid hormone signaling pathway
    16653 (Kras)
   04916 Melanogenesis
    16653 (Kras)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16653 (Kras)
  Nervous system
   04725 Cholinergic synapse
    16653 (Kras)
   04726 Serotonergic synapse
    16653 (Kras)
   04720 Long-term potentiation
    16653 (Kras)
   04730 Long-term depression
    16653 (Kras)
   04722 Neurotrophin signaling pathway
    16653 (Kras)
  Development
   04320 Dorso-ventral axis formation
    16653 (Kras)
   04360 Axon guidance
    16653 (Kras)
  Aging
   04211 Longevity regulating pathway - mammal
    16653 (Kras)
   04213 Longevity regulating pathway - multiple species
    16653 (Kras)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    16653 (Kras)
   05230 Central carbon metabolism in cancer
    16653 (Kras)
   05231 Choline metabolism in cancer
    16653 (Kras)
   05206 MicroRNAs in cancer
    16653 (Kras)
   05205 Proteoglycans in cancer
    16653 (Kras)
   05203 Viral carcinogenesis
    16653 (Kras)
   05210 Colorectal cancer
    16653 (Kras)
   05212 Pancreatic cancer
    16653 (Kras)
   05214 Glioma
    16653 (Kras)
   05216 Thyroid cancer
    16653 (Kras)
   05221 Acute myeloid leukemia
    16653 (Kras)
   05220 Chronic myeloid leukemia
    16653 (Kras)
   05218 Melanoma
    16653 (Kras)
   05211 Renal cell carcinoma
    16653 (Kras)
   05219 Bladder cancer
    16653 (Kras)
   05215 Prostate cancer
    16653 (Kras)
   05213 Endometrial cancer
    16653 (Kras)
   05223 Non-small cell lung cancer
    16653 (Kras)
  Substance dependence
   05034 Alcoholism
    16653 (Kras)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    16653 (Kras)
  Infectious diseases
   05166 HTLV-I infection
    16653 (Kras)
   05161 Hepatitis B
    16653 (Kras)
   05160 Hepatitis C
    16653 (Kras)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    16653 (Kras)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    16653 (Kras)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 77.37 cM; 6 G2
AA seq 188 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SRTRCTVM
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtggttggagctggtggcgtaggcaagagcgccttgacg
atacagctaattcagaatcactttgtggatgagtatgaccctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctggtagggaataagtgtgatttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttacgggattccg
ttcattgagacctcagcaaagacaagacagggtgttgacgatgccttctatacattagtc
cgagaaattcgaaaacataaagaaaagatgagcaaagatgggaagaagaagaagaagaag
tcaaggacaaggtgtacagttatgtga

DBGET integrated database retrieval system