KEGG   Mus musculus (mouse): 17096Help
Entry
17096             CDS       T01002                                 

Gene name
Lyn, AA407514, Hck-2, p53Lyn, p56Lyn
Definition
(RefSeq) LYN proto-oncogene, Src family tyrosine kinase (EC:2.7.10.2)
  KO
K05854  
tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
Platelet activation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Long-term depression
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    17096 (Lyn)
 Organismal Systems
  Immune system
   04611 Platelet activation
    17096 (Lyn)
   04662 B cell receptor signaling pathway
    17096 (Lyn)
   04664 Fc epsilon RI signaling pathway
    17096 (Lyn)
   04666 Fc gamma R-mediated phagocytosis
    17096 (Lyn)
   04062 Chemokine signaling pathway
    17096 (Lyn)
  Nervous system
   04730 Long-term depression
    17096 (Lyn)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    17096 (Lyn)
  Infectious diseases
   05169 Epstein-Barr virus infection
    17096 (Lyn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     17096 (Lyn)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   17096 (Lyn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4 A1; 4 2.05 cM
AA seq 512 aa AA seqDB search
MGCIKSKRKDNLNDDEVDSKTQPVRNTDRTIYVRDPTSNKQQRPVPEFHLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtattaaatcaaaaaggaaagacaatctcaatgacgatgaagtagattcgaag
actcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttcctgaatttcatcttttaccaggacagagatttcaaacaaaagat
ccagaggaacaaggtgacattgtggtggccttatacccttatgatggcatccacccagat
gacttgtccttcaagaaaggagaaaagatgaaagttctagaagagcatggggaatggtgg
aaagctaagtccctttcatcaaagagagaaggcttcatccccagcaactacgtggccaag
gtcaacaccttagaaactgaagagtggttcttcaaggacataacaaggaaagatgcagag
cgacagcttctggcaccagggaacagtgcaggagctttccttatcagagaaagcgaaact
ttaaagggaagcttctctctttctgtcagagattatgaccctatgcatggtgatgtcatt
aagcactacaaaattagaagtctggacaatggtggctattacatctctcctcgcatcact
tttccctgcatcagtgacatgattaagcattaccaaaagcagtctgatggtctatgcaga
agactggagaaggcatgcatcagtcccaaacctcagaagccatgggataaagatgcctgg
gagatcccccgggagtccattaagttggtgaaaaagcttggcgcagggcagtttggggaa
gtctggatgggttactataacaacagcacaaaggtggctgtgaagaccctcaagcccggc
accatgtctgtgcaggcattcctggaagaggccaacctcatgaagaccttgcaacatgac
aagctagtgcggctgtacgctgtggtcaccaaggaggagcccatctacatcatcaccgag
ttcatggctaagggtagtttgctggatttcctcaagagtgatgaaggtggcaaggtgctg
ctgcccaagctcattgacttctcggcccagattgcagaaggcatggcgtacatcgagcgg
aagaactacatccaccgtgatctgcgagctgctaacgtcctggtctctgagtcactcatg
tgcaagattgcagactttggcctcgcgagagtcatcgaagataacgagtacacagcaagg
gaaggtgcgaagttccctatcaagtggacagctccagaggccatcaacttcggctgcttc
actatcaaatctgacgtgtggtccttcggaattctcctgtatgagattgtcacctatggg
aagattccctacccagggagaaccaacgcagatgtgatgagcgcactgtcacagggatat
cgaatgccacgcatggagaactgcccagatgagctctatgacatcatgaaaatgtgttgg
aaagaaaaggcagaggagaggccaacttttgactacttacagagtgtcctggatgacttc
tatacagccacagaagggcagtatcagcagcaaccgtag

DBGET integrated database retrieval system