KEGG   Mus musculus (mouse): 171166Help
Entry
171166            CDS       T01002                                 

Gene name
Mcoln3, 6720490O21Rik, TRPML3, Va
Definition
(RefSeq) mucolipin 3
  KO
K04994  
mucolipin 3
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPML (Mucolipin)
   171166 (Mcoln3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 H2; 3 71.03 cM
AA seq 553 aa AA seqDB search
MANPEVLVSSCRARQDESPCTFHPSSSPSEQLLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS
EVYDQIIFAVTQYLQLQNISVGNHAYENKGTKQSAMAICQHFYRQGTICPGNDTFDIDPE
VETECFLVEPDEASHLGTPGENKLNLSLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIKECKDWHVSGSIQKNTHYMMIFDAFVILTCLASL
VLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFINGWYIMIIISDILTIVGSVLKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVMRFCCCAA
MIYLGYCFCGWIVLGPYHEKFRSLNRVSECLFSLINGDDMFSTFAKMQQKSYLVWLFSRV
YLYSFISLFIYMILSLFIALITDTYETIKHYQQDGFPETELRKFIAECKDLPNSGKYRLE
DDPPGSLLCCCKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcccgaggtgctggttagcagctgcagagctcgccaagatgaaagcccctgc
actttccacccgagctcgtccccgtcagagcagcttctcttagaagaccagatgaggcgg
aaactcaagttcttttttatgaatccttgtgagaagttctgggctcggggtaggaagcca
tggaaacttgccatacagattctgaaaatcgcgatggtgactatccagctggttctgttt
ggactaagtaaccagatggtagtagctttcaaagaggagaacactatagccttcaaacac
ctcttcctaaagggctacatggatcgaatggacgacacctatgcagtgtacactcagagt
gaagtgtatgaccagatcatctttgcagtgacccagtacttgcagcttcagaacatctcc
gtgggcaatcacgcttatgagaacaaggggactaagcagtcggcgatggcaatctgtcag
cacttctacaggcaaggaaccatctgccccgggaacgacacctttgacatcgatccagaa
gttgaaacagaatgtttccttgtagagccagatgaagcttcccaccttggaacgcctgga
gaaaataaactcaacctgagcctggacttccacagacttctgacggtggagctccagttt
aagctcaaagccatcaatctgcagacagttcgacaccaggagcttcctgactgttacgac
tttacgctgactataacattcgacaacaaggctcacagtggaagaatcaaaataagctta
gacaacgacatttctatcaaagaatgcaaagactggcatgtgtctggatcaattcagaag
aacacacactacatgatgatctttgatgcctttgtcattctgacctgcttggcctcactg
gtgctgtgtgccaggtctgtgattaggggtcttcagcttcagcaggagtttgtcaacttc
ttccttcttcactacaagaaggaagtttcggcctctgatcagatggagttcatcaacggg
tggtacattatgatcatcattagtgacatattgacaatcgttggatcagttctgaaaatg
gaaatccaagccaagagtctcacaagctatgatgtctgcagcatacttctcgggacgtca
actatgctcgtgtggcttggagttatccgatacctgggtttctttgcgaagtacaatctc
cttattctgaccctccaggcagcgctgcccaacgtcatgaggttctgttgctgcgctgct
atgatctatctaggctattgcttttgcggatggattgtgctgggcccttaccatgagaag
ttccgttccctgaacagggtctccgagtgcctgttctcgctgataaacggagacgatatg
ttttccacatttgcgaaaatgcagcagaagagttacctggtgtggctgttcagccgagtc
tacctgtactcgttcatcagcctcttcatttacatgattctgagccttttcatcgcgctc
atcacagacacatacgaaacaattaagcactaccagcaagatggcttcccagagacggaa
cttcgaaagtttatagcggaatgcaaagacctccccaactccggaaaatacagattagaa
gatgaccctccgggttctttactctgctgctgcaaaaagtaa

DBGET integrated database retrieval system