KEGG   Mus musculus (mouse): 17388Help
Entry
17388             CDS       T01002                                 

Gene name
Mmp15, AI503551, MT-MMP_2, MT2-MMP
Definition
(RefSeq) matrix metallopeptidase 15
  KO
K07995  
matrix metalloproteinase-15 (membrane-inserted) [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     17388 (Mmp15)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17388 (Mmp15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 D1; 8 47.12 cM
AA seq 657 aa AA seqDB search
MGSDRSALGRPGCTGSCLSSRASLLPLLLVLLDCLGHGTASKDAEVYAAENWLRLYGYLP
QPSRHMSTMRSAQILASALAEMQSFYGIPVTGVLDEETKTWMKRPRCGVPDQFGVHVKAN
LRRRRKRYTLTGKAWNNYHLTFSIQNYTEKLGWYNSMEAVRRAFQVWEQVTPLVFQEVSY
DDIRLRRRAEADIMVLFASGFHGDSSPFDGVGGFLAHAYFPGPGLGGDTHFDADEPWTFS
STDLHGISLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDTDNFQLPEDDLRGIQQLYG
SPDGKPQPTRPLPTVRPRRPGRPDHQPPRPPQPPHPGGKPERPPKPGPPPQPRATERPDQ
YGPNICDGNFDTVAVLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGNISAAYE
RQDGHFVFFKGNRYWLFREANLEPGYPQPLSSYGTDIPYDRIDTAIWWEPTGHTFFFQAD
RYWRFNEETQHGDPGYPKPISVWQGIPTSPKGAFLSNDAAYTYFYKGTKYWKFNNERLRM
EPGHPKSILRDFMGCQEHVEPRSRWPDVARPPFNPNGGAEPEADGDSKEENAGDKDEGSR
VVVQMEEVVRTVNVVMVLVPLLLLLCILGLAFALVQMQRKGAPRMLLYCKRSLQEWV
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgaccggagcgcactcggacgtccaggctgcactggcagctgcctcagcagc
cgagcttcgctgctcccgctgctactggtgcttctggactgtctgggccatggtacagcg
tctaaagacgccgaagtgtacgccgcggagaactggctgcggctctatggctacctaccc
cagcccagccgccacatgtccaccatgcgctctgcccagatcctggcctccgcccttgcc
gagatgcagagtttctatgggatccctgtcacgggtgtgcttgatgaagagacgaaaacg
tggatgaagcggccccgatgtggggttcctgatcagtttggggtacatgtgaaagccaac
ctgcgtcgacggcggaaacgttacaccctgacaggaaaggcatggaacaattaccacctg
accttcagcatccagaactacactgagaagctgggctggtacaactccatggaggcggtg
cgcagggctttccaagtgtgggagcaggtcacaccattggtcttccaggaagtatcctat
gatgacattcggctacgaaggcgagcggaggctgacatcatggtactctttgcctctggc
ttccatggcgacagctcaccgtttgatggcgtgggtggctttctggcccacgcttatttc
cccggccctggtctgggtggggacacccatttcgacgcagatgaaccctggaccttctcc
agcactgacctgcatggaatcagcctctttctggtggccgtgcatgagctgggccatgcc
ctggggctagaacactcaagtaaccccagcgctattatggcacccttctaccagtggatg
gataccgacaacttccagctgcccgaagatgaccttcggggcatccagcagctgtatggc
tccccagatggtaagccacagcccacccggcctctccccactgtgaggccccggcggcca
ggacggccagatcaccagccacctcggcctccccagccaccacatccaggtgggaagcca
gaaaggccccccaaaccagggcccccaccccagccccgagccacagagaggcctgaccag
tatggccccaacatctgcgatggcaacttcgacacagtggctgtgctccgcggagagatg
tttgtgttcaagggccgctggttctggcgagtcaggcacaaccgcgttctagacaactac
cccatgccaattggccacttctggcgcggtctgccggggaacatcagtgctgcctacgag
cgccaggatggacattttgtcttcttcaaaggtaaccgctactggcttttccgagaagcc
aatctggagcccggctacccacagccgctgagcagctatggcacagacatcccctatgac
cgcattgacacagccatctggtgggagcccacaggtcacaccttcttctttcaagcagac
aggtactggcgcttcaacgaggagacacagcatggagaccctggctaccccaagcccatc
agtgtctggcaggggatccccacctctcccaaaggggccttcctcagcaacgatgcagcc
tacacctacttctacaagggcaccaagtactggaaattcaacaacgaacgcctacggatg
gaacccggccaccccaaatccatcctgcgggacttcatgggctgccaggagcacgtggag
ccccgatcgcgatggcccgatgtggctcgtccacccttcaaccccaacgggggtgccgag
cctgaggcagatggtgacagcaaggaagagaacgcgggtgacaaggatgagggcagccgc
gtggtggtgcagatggaggaggtggtccggacagtgaacgtggtgatggtgttggtcccc
ttgctgctgttgctctgtattctgggcctggcctttgctctggtgcagatgcagcgcaag
ggcgcccctcgcatgctgctctactgcaagcgctcactgcaggagtgggtgtga

DBGET integrated database retrieval system