KEGG   Mus musculus (mouse): 17977Help
Entry
17977             CDS       T01002                                 

Gene name
Ncoa1, KAT13A, SRC-1, SRC1, bHLHe74
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    17977 (Ncoa1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     17977 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12; 12 A2-A3
AA seq 1405 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPEDPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARVNR
QQSSDLNSSSSHTNSSNNQGNFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNNSPMEGT
GIALSQFMSPRRQANSGLATRARMSNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVT
SLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDSKEIASILNEMIQSD
NSDNSANEGKPLDSGLLHNNDRLSEGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKD
VLSCTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSVP
ASTAVSVSGQSQGSASIKLELDAAKKKESKDHQLLRYLLDKDEKDLRSTPNLCLDDVKVK
VEKKEQMDPCNTNPTPMTKPAPEEVKLESQSQFTADLDQFDQLLPTLEKAAQLPSLCETD
RMDGAVTGVSIKAEVLPASLQPTTARAAPRLSRLPELELEAIDNQFGQPGAGDQIPWANN
TLTTINQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRA
LGIDKLVQGGGLDVLSERFPPQQATPPLMMEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQ
KPSLGAMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQ
AILNQFAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAML
MRHQSFGNNIPPSSGLPVQMGTPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANP
EASLATRSSMVNRGMAGNMGGQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSS
MVPMPVPPPQSSLLQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNN
MSITVSMAGGNANIQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSST
DLLKTDADGNQDKKTEEFFSVVTTD
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatcagaccctgcaaacccagactctcataagagaaaa
ggatcgccatgtgacacgctggcatcaagtactgagaagaggcgcagggagcaagaaaat
aagtatttagaagaactagctgaactactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagattttgaagaagacagtagatcagatacagctaatg
aagagaatggagcaagagaaatccacgactgatgatgacgtgcagaagtccgacatctcc
tcgagcagccaaggagtgatagagaaggagtcgctgggccctcttcttctggaggctttg
gatggatttttctttgttgtgaactgtgaaggaagaattgtatttgtatcagaaaatgtg
accagctacttgggttacaatcaggaagaattaatgaataccagcgtctacagcatactg
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgccgaaatagccatacatttaactgcaggatgcta
attcaccctccagaggacccaggtactgagaaccaagaagcttgccagcgctatgaagta
atgcagtgtttcacagtgtcacagccaaaatccatccaagaagatggtgaagatttccag
tcatgtctgatttgtattgctcgacgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggcaaaatcatctctattgacactagctccctg
agggctgctggcaggactggctgggaagacctagtaaggaagtgcatctatgctttcttc
caacctcagggcagagagccatcttacgcccggcagctgtttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtcctgacatgcagcctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacagtaattctgga
atgtcaattccccgaataaatccctcagtcaatcctggtatctctccagcccatggtgtg
acccgttcatccacgttgccaccatccaacaacaacatggtctctgccagagtaaaccgc
caacagagctcagacctcaacagcagcagcagtcatactaactctagcaacaaccaaggg
aactttggatgttcacctggaaatcagattgtagccaatgttgccttaaaccagggacag
gcaggttcccagagcagcaatccctctttaaacctcaataattctcctatggaaggtaca
ggaattgccctctcacagttcatgtctccgaggagacaagctaattctggcttggcaaca
agggccaggatgtcaaacaattcatttcctccaaatattccaacattaagctccccagtt
ggcattactagtggtgcctgtaataataataatcgatcctattcaaatatcccagtaaca
tctttacaaggtatgaatgaaggacccaataactctgttggcttctctgctgggtctcca
gtccttcggcagatgagctcacagaattcacctagcagattaagtatgcaaccagcaaag
gctgagtccaaagacagcaaagagattgcatccattttaaatgaaatgattcagtccgac
aacagcgacaacagtgctaacgaaggcaagcctctggactcaggacttctgcataacaat
gacagactctcagaaggagacagtaaatactctcaaactagtcacaagctagtacagcta
ttgactacgaccgcagagcagcagttacggcatgccgacatagacacaagctgcaaagat
gtactgtcttgcactggtacttccagctctgcctcctctaacccctcaggaggtacttgt
ccctcttctcacagctctctgactgagcggcataaaattctgcaccggcttttacaggag
ggcagcccctcagacatcaccactttgtctgtggaacccgagaagaaggacagtgtgcca
gcctctactgctgtgtcagtgtctggacaatcccaggggagtgccagcataaaactggaa
ctggatgctgcaaagaaaaaagagtcaaaagaccatcagctcctacgctaccttttagac
aaagatgagaaagatttaaggtccactccaaacctgtgcctggatgacgtaaaggtcaaa
gtggagaagaaagaacagatggatccttgtaacacaaacccaaccccaatgaccaaacct
gctcctgaggaagttaaactggagtcccagagccagtttacagctgaccttgaccagttt
gatcagttattgcccaccctggagaaggcagcacagttgccgagcttgtgcgagacagac
aggatggatggtgcggtcaccggtgtcagcatcaaggcggaggtcctgccagcgtcactc
cagcccaccactgccagagctgcccccaggctgagcagattgcctgaactagaattagaa
gcgatcgataaccagtttggacaaccaggagcgggggatcagattccatgggcaaataat
actttgacaacaataaatcagaataaaccagaagaccaatgtattagctcacagctggat
gagctcctctgtccaccaacaacagtagaaggaagaaacgatgagaaggcccttctggaa
caactggtgtctttcctcagtggcaaagatgaaacggagctggctgagctagaccgggca
ctggggatcgacaagctcgtccagggaggcggattagatgtattatctgagcgatttcca
ccacagcaagcaacaccacctttgatgatggaagacagacccaccctctattcccagcca
tactcatctccttctcccaccgctggtctctctggccctttccaaggcatggtccggcag
aagccttcactgggggctatgccggttcaagtaacacctcctcgaggaaccttttcaccc
aacatgggcatgcagccccggcagactctcaatagacctccagctgcacccaaccagctt
cggctgcagctgcagcagcggctacaggggcagcagcagttgatgcaccaaaaccggcaa
gccatcttgaaccagtttgcagcaaatgctcctgttggcatgaacatgaggtcaggcatg
cagcagcagatcacacctcagccacccttgaatgctcagatgttggcccagcgccagcgg
gagttgtacagtcagcagcatcgacagaggcaaattatacagcagcagagagccatgctc
atgaggcaccaaagttttgggaacaacatccctccttcatctggactcccagttcaaatg
gggactccccgtcttcctcagggtgctccccagcagttcccctacccaccaaactatggt
acaaacccaggaaccccacctgcctccaccagccctttctctcaactggcagcaaaccct
gaggcctccttggccacccgcagcagcatggtgaacagaggcatggcagggaacatggga
ggacagtttggcgctggcatcagtcctcagatgcagcagaatgtcttccaatatccagga
ccaggactagttccccaaggtgaggccacctttgccccatctctaagccctgggagctcc
atggtgccgatgccagtccctcctcctcaaagctctctgctccagcaaactccacctact
tctgggtaccagtcaccagacatgaaggcctggcagcaaggaacaatgggaaacaacaat
gtgttcagtcaagctgtccagagccagcctgcacctgcacagccaggagtgtacaacaac
atgagcatcaccgtgtccatggcaggtggaaacgcaaacattcagaacatgaatccaatg
atgggccagatgcaaatgagctctctgcagatgccagggatgaatactgtgtgctctgag
cagatgaatgatccagcactgagacacacaggcctctactgcaaccagctctcgtccact
gaccttctcaaaacagacgcagatggaaaccaggacaagaagacagaagagttcttctct
gtggtgactacagactag

DBGET integrated database retrieval system