KEGG   Mus musculus (mouse): 17977Help
Entry
17977             CDS       T01002                                 

Gene name
Ncoa1, KAT13A, NCoA-1, NRC-1, SRC-1, SRC-a, SRC1, bHLHe74, mNRC-1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    17977 (Ncoa1)
   04919 Thyroid hormone signaling pathway
    17977 (Ncoa1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    17977 (Ncoa1)
   05224 Breast cancer
    17977 (Ncoa1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     17977 (Ncoa1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    17977 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 NCOA_u2 DUF1518 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 17977
NCBI-ProteinID: NP_035011
MGI: 1276523
Ensembl: ENSMUSG00000020647
UniProt: P70365
Structure
PDB: 

Jmol
Position
12; 12 A1.1
AA seq 1405 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPEDPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARVNR
QQSSDLNSSSSHTNSSNNQGNFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNNSPMEGT
GIALSQFMSPRRQANSGLATRARMSNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVT
SLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDSKEIASILNEMIQSD
NSDNSANEGKPLDSGLLHNNDRLSEGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKD
VLSCTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSVP
ASTAVSVSGQSQGSASIKLELDAAKKKESKDHQLLRYLLDKDEKDLRSTPNLCLDDVKVK
VEKKEQMDPCNTNPTPMTKPAPEEVKLESQSQFTADLDQFDQLLPTLEKAAQLPSLCETD
RMDGAVTGVSIKAEVLPASLQPTTARAAPRLSRLPELELEAIDNQFGQPGAGDQIPWANN
TLTTINQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRA
LGIDKLVQGGGLDVLSERFPPQQATPPLMMEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQ
KPSLGAMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQ
AILNQFAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAML
MRHQSFGNNIPPSSGLPVQMGTPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANP
EASLATRSSMVNRGMAGNMGGQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSS
MVPMPVPPPQSSLLQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNN
MSITVSMAGGNANIQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSST
DLLKTDADGNQDKKTEEFFSVVTTD
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatcagaccctgcaaacccagactctcataagagaaaa
ggatcgccatgtgacacgctggcatcaagtactgagaagaggcgcagggagcaagaaaat
aagtatttagaagaactagctgaactactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagattttgaagaagacagtagatcagatacagctaatg
aagagaatggagcaagagaaatccacgactgatgatgacgtgcagaagtccgacatctcc
tcgagcagccaaggagtgatagagaaggagtcgctgggccctcttcttctggaggctttg
gatggatttttctttgttgtgaactgtgaaggaagaattgtatttgtatcagaaaatgtg
accagctacttgggttacaatcaggaagaattaatgaataccagcgtctacagcatactg
catgtgggagatcatgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgccgaaatagccatacatttaactgcaggatgcta
attcaccctccagaggacccaggtactgagaaccaagaagcttgccagcgctatgaagta
atgcagtgtttcacagtgtcacagccaaaatccatccaagaagatggtgaagatttccag
tcatgtctgatttgtattgctcgacgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggcaaaatcatctctattgacactagctccctg
agggctgctggcaggactggctgggaagacctagtaaggaagtgcatctatgctttcttc
caacctcagggcagagagccatcttacgcccggcagctgtttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtcctgacatgcagcctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacagtaattctgga
atgtcaattccccgaataaatccctcagtcaatcctggtatctctccagcccatggtgtg
acccgttcatccacgttgccaccatccaacaacaacatggtctctgccagagtaaaccgc
caacagagctcagacctcaacagcagcagcagtcatactaactctagcaacaaccaaggg
aactttggatgttcacctggaaatcagattgtagccaatgttgccttaaaccagggacag
gcaggttcccagagcagcaatccctctttaaacctcaataattctcctatggaaggtaca
ggaattgccctctcacagttcatgtctccgaggagacaagctaattctggcttggcaaca
agggccaggatgtcaaacaattcatttcctccaaatattccaacattaagctccccagtt
ggcattactagtggtgcctgtaataataataatcgatcctattcaaatatcccagtaaca
tctttacaaggtatgaatgaaggacccaataactctgttggcttctctgctgggtctcca
gtccttcggcagatgagctcacagaattcacctagcagattaagtatgcaaccagcaaag
gctgagtccaaagacagcaaagagattgcatccattttaaatgaaatgattcagtccgac
aacagcgacaacagtgctaacgaaggcaagcctctggactcaggacttctgcataacaat
gacagactctcagaaggagacagtaaatactctcaaactagtcacaagctagtacagcta
ttgactacgaccgcagagcagcagttacggcatgccgacatagacacaagctgcaaagat
gtactgtcttgcactggtacttccagctctgcctcctctaacccctcaggaggtacttgt
ccctcttctcacagctctctgactgagcggcataaaattctgcaccggcttttacaggag
ggcagcccctcagacatcaccactttgtctgtggaacccgagaagaaggacagtgtgcca
gcctctactgctgtgtcagtgtctggacaatcccaggggagtgccagcataaaactggaa
ctggatgctgcaaagaaaaaagagtcaaaagaccatcagctcctacgctaccttttagac
aaagatgagaaagatttaaggtccactccaaacctgtgcctggatgacgtaaaggtcaaa
gtggagaagaaagaacagatggatccttgtaacacaaacccaaccccaatgaccaaacct
gctcctgaggaagttaaactggagtcccagagccagtttacagctgaccttgaccagttt
gatcagttattgcccaccctggagaaggcagcacagttgccgagcttgtgcgagacagac
aggatggatggtgcggtcaccggtgtcagcatcaaggcggaggtcctgccagcgtcactc
cagcccaccactgccagagctgcccccaggctgagcagattgcctgaactagaattagaa
gcgatcgataaccagtttggacaaccaggagcgggggatcagattccatgggcaaataat
actttgacaacaataaatcagaataaaccagaagaccaatgtattagctcacagctggat
gagctcctctgtccaccaacaacagtagaaggaagaaacgatgagaaggcccttctggaa
caactggtgtctttcctcagtggcaaagatgaaacggagctggctgagctagaccgggca
ctggggatcgacaagctcgtccagggaggcggattagatgtattatctgagcgatttcca
ccacagcaagcaacaccacctttgatgatggaagacagacccaccctctattcccagcca
tactcatctccttctcccaccgctggtctctctggccctttccaaggcatggtccggcag
aagccttcactgggggctatgccggttcaagtaacacctcctcgaggaaccttttcaccc
aacatgggcatgcagccccggcagactctcaatagacctccagctgcacccaaccagctt
cggctgcagctgcagcagcggctacaggggcagcagcagttgatgcaccaaaaccggcaa
gccatcttgaaccagtttgcagcaaatgctcctgttggcatgaacatgaggtcaggcatg
cagcagcagatcacacctcagccacccttgaatgctcagatgttggcccagcgccagcgg
gagttgtacagtcagcagcatcgacagaggcaaattatacagcagcagagagccatgctc
atgaggcaccaaagttttgggaacaacatccctccttcatctggactcccagttcaaatg
gggactccccgtcttcctcagggtgctccccagcagttcccctacccaccaaactatggt
acaaacccaggaaccccacctgcctccaccagccctttctctcaactggcagcaaaccct
gaggcctccttggccacccgcagcagcatggtgaacagaggcatggcagggaacatggga
ggacagtttggcgctggcatcagtcctcagatgcagcagaatgtcttccaatatccagga
ccaggactagttccccaaggtgaggccacctttgccccatctctaagccctgggagctcc
atggtgccgatgccagtccctcctcctcaaagctctctgctccagcaaactccacctact
tctgggtaccagtcaccagacatgaaggcctggcagcaaggaacaatgggaaacaacaat
gtgttcagtcaagctgtccagagccagcctgcacctgcacagccaggagtgtacaacaac
atgagcatcaccgtgtccatggcaggtggaaacgcaaacattcagaacatgaatccaatg
atgggccagatgcaaatgagctctctgcagatgccagggatgaatactgtgtgctctgag
cagatgaatgatccagcactgagacacacaggcctctactgcaaccagctctcgtccact
gaccttctcaaaacagacgcagatggaaaccaggacaagaagacagaagagttcttctct
gtggtgactacagactag

DBGET integrated database retrieval system