KEGG   Mus musculus (mouse): 18035Help
Entry
18035             CDS       T01002                                 

Gene name
Nfkbia, AI462015, Nfkbi
Definition
nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, alpha
Orthology
K04734  
NF-kappa-B inhibitor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Prostate cancer
Chronic myeloid leukemia
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    18035 (Nfkbia)
   04668 TNF signaling pathway
    18035 (Nfkbia)
   04024 cAMP signaling pathway
    18035 (Nfkbia)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    18035 (Nfkbia)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    18035 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    18035 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    18035 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    18035 (Nfkbia)
   04660 T cell receptor signaling pathway
    18035 (Nfkbia)
   04662 B cell receptor signaling pathway
    18035 (Nfkbia)
   04062 Chemokine signaling pathway
    18035 (Nfkbia)
  Endocrine system
   04920 Adipocytokine signaling pathway
    18035 (Nfkbia)
  Nervous system
   04722 Neurotrophin signaling pathway
    18035 (Nfkbia)
  Development
   04380 Osteoclast differentiation
    18035 (Nfkbia)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18035 (Nfkbia)
   05203 Viral carcinogenesis
    18035 (Nfkbia)
   05220 Chronic myeloid leukemia
    18035 (Nfkbia)
   05215 Prostate cancer
    18035 (Nfkbia)
   05222 Small cell lung cancer
    18035 (Nfkbia)
  Infectious diseases
   05134 Legionellosis
    18035 (Nfkbia)
   05166 HTLV-I infection
    18035 (Nfkbia)
   05162 Measles
    18035 (Nfkbia)
   05164 Influenza A
    18035 (Nfkbia)
   05161 Hepatitis B
    18035 (Nfkbia)
   05160 Hepatitis C
    18035 (Nfkbia)
   05168 Herpes simplex infection
    18035 (Nfkbia)
   05169 Epstein-Barr virus infection
    18035 (Nfkbia)
   05145 Toxoplasmosis
    18035 (Nfkbia)
   05140 Leishmaniasis
    18035 (Nfkbia)
   05142 Chagas disease (American trypanosomiasis)
    18035 (Nfkbia)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    18035 (Nfkbia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 C1-C3
AA seq 314 aa AA seqDB search
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP
LAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATN
YNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagccagctgggcacggccaggactgggccatggagggcccgcgggatggcctc
aagaaggagcgcttggtggacgatcgccacgacagcggcctggactccatgaaggacgag
gagtacgagcaaatggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgccg
ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg
gcaatcatccacgaagagaagccgctgaccatggaagtcattggtcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccaggaattgctgaggcacttctgaaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta
gcagtcttgacgcagacctgcacaccccagcatctccactccgtcctgcaggccaccaac
tacaatggccacacgtgtctgcacctagcctctatccacggctacctggccatcgtggag
cacttggtgactttgggtgctgatgtcaacgctcaggagccctgcaatggccggacagcc
ctccaccttgcggtggacctgcagaatcctgacctggtttcgctcttgttgaaatgtggg
gctgatgtcaacagggtaacctaccaaggctactccccctaccagcttacctggggccgc
ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatctccagatgcta
cccgagagcgaggatgaggagagctatgacacggagtcagaattcacagaggatgagctg
ccctatgatgactgtgtgtttggaggccagcgtctgacattataa

DBGET integrated database retrieval system