KEGG   Mus musculus (mouse): 18035Help
Entry
18035             CDS       T01002                                 

Gene name
Nfkbia, AI462015, Nfkbi
Definition
nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, alpha
Orthology
K04734  
NF-kappa-B inhibitor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Prostate cancer
Chronic myeloid leukemia
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:mmu04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mmu04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mmu04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mmu04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:mmu04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:mmu04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:mmu04623]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mmu04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:mmu04662]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:mmu04062]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mmu04920]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mmu04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:mmu04380]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mmu05220]
Human Diseases; Cancers; Prostate cancer [PATH:mmu05215]
Human Diseases; Cancers; Small cell lung cancer [PATH:mmu05222]
Human Diseases; Infectious diseases; Legionellosis [PATH:mmu05134]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Measles [PATH:mmu05162]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mmu05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:mmu05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mmu05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mmu05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mmu05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:mmu05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mmu05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 C1-C3
AA seq 314 aa AA seqDB search
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP
LAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATN
YNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagccagctgggcacggccaggactgggccatggagggcccgcgggatggcctc
aagaaggagcgcttggtggacgatcgccacgacagcggcctggactccatgaaggacgag
gagtacgagcaaatggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgccg
ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg
gcaatcatccacgaagagaagccgctgaccatggaagtcattggtcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccaggaattgctgaggcacttctgaaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta
gcagtcttgacgcagacctgcacaccccagcatctccactccgtcctgcaggccaccaac
tacaatggccacacgtgtctgcacctagcctctatccacggctacctggccatcgtggag
cacttggtgactttgggtgctgatgtcaacgctcaggagccctgcaatggccggacagcc
ctccaccttgcggtggacctgcagaatcctgacctggtttcgctcttgttgaaatgtggg
gctgatgtcaacagggtaacctaccaaggctactccccctaccagcttacctggggccgc
ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatctccagatgcta
cccgagagcgaggatgaggagagctatgacacggagtcagaattcacagaggatgagctg
ccctatgatgactgtgtgtttggaggccagcgtctgacattataa

DBGET integrated database retrieval system