KEGG   Mus musculus (mouse): 18549Help
Entry
18549             CDS       T01002                                 

Gene name
Pcsk2, 6330411F23Rik, AI839700, Nec-2, Nec2, PC2, Phpp-2, SPC2
Definition
proprotein convertase subtilisin/kexin type 2 (EC:3.4.21.94)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     18549 (Pcsk2)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S8: subtilisin family
   18549 (Pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 F3-H2; 2 70.89 cM
AA seq 637 aa AA seqDB search
MEGGCGSQWKAAGFLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLP
FAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINM
NDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNY
NADASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRML
DQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKG
SIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKR
NPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTVLTSKRNQ
LHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPP
TGKLVLTLKTNACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPR
DDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPYID
QVVRDYQSKLAMSKKQELEEELDEAVERSLQSILRKN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggttgtggatcccagtggaaggcggccgggttcctcttctgtgtgatggtt
tttgcgtctgccgagagacccgtcttcacgaatcattttcttgtggagttgcataaagac
ggagaggaagaggctcgccaagttgcagcagaacacggctttggagtccgaaagctcccc
tttgcagaaggcctgtatcacttttatcacaatgggcttgcaaaggccaaaagaagacgc
agcctacaccataagcggcagctagagagagaccccaggataaagatggcgctgcaacaa
gaaggatttgaccgtaaaaagagagggtacagggacatcaatgagattgacatcaacatg
aatgatcctctctttacaaagcaatggtacctgttcaacactgggcaagccgatggaact
cctgggctagacttgaacgtggccgaagcctgggagctgggatacacaggaaaaggagtg
accattggaattatggatgatggaattgactatctccacccagacctggcctacaactac
aacgctgatgcaagttatgacttcagcagcaatgacccctacccataccctcgatacaca
gatgactggttcaacagccatggaactaggtgtgcaggagaagtttctgctgcagccagc
aacaatatctgtggagtcggcgtagcatacaactccaaggtggcagggatccggatgctg
gaccagccctttatgacagacatcatcgaagcctcctccatcagccacatgcctcaactg
atcgacatctacagtgcaagctggggccccacagacaatgggaagacggttgatgggccc
cgagagctcacactccaggccatggctgatggcgtgaacaagggccgtgggggcaaaggc
agcatctatgtgtgggcctctggggacggtggcagctacgatgactgcaactgtgacggc
tatgcttcaagcatgtggaccatctccatcaactcagccatcaatgatggcaggactgcc
ttgtatgatgagagttgctcttccaccttagcatccaccttcagcaatgggaggaagagg
aatcctgaggctggtgtggctaccacagacttgtatggcaactgtactctgagacactct
gggacatctgcagctgctccggaggcagctggcgtgtttgcattagctttggaggctaac
ctggatctgacctggagagacatgcaacatctgactgtgctcacctccaagcggaaccag
cttcatgatgaggttcatcagtggcgacggaatggggttggcctggaatttaatcacctc
tttggctacggagtccttgatgcaggtgccatggtgaaaatggctaaagactggaaaact
gttccggagagattccattgtgtgggaggctctgtgcagaaccctgaaaaaataccaccc
accggcaagctggtactgaccctcaaaacaaatgcatgtgaggggaaggaaaacttcgtc
cgctacctggagcacgtccaagctgtcatcacagtcaacgcgaccaggagaggagacctg
aacatcaacatgacctccccaatgggcaccaagtccattttgctgagccggcgtcccaga
gacgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacacctggggg
gaggatgcccgagggacctggaccctggagctggggtttgtgggcagtgcaccacagaag
gggttgctgaaggaatggaccctgatgcttcacggcacacagagcgccccatacatcgat
caggtggtgagggattaccagtctaagctggccatgtccaagaagcaggagctggaggaa
gagctggatgaggctgtggagagaagcctgcaaagtatcctgagaaagaactag

DBGET integrated database retrieval system