KEGG   Mus musculus (mouse): 18708Help
Entry
18708             CDS       T01002                                 

Gene name
Pik3r1, PI3K, p50alpha, p55alpha, p85alpha
Definition
(RefSeq) phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha)
  KO
K02649  
phosphoinositide-3-kinase, regulatory subunit
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Platinum drug resistance
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    18708 (Pik3r1)
   04015 Rap1 signaling pathway
    18708 (Pik3r1)
   04012 ErbB signaling pathway
    18708 (Pik3r1)
   04370 VEGF signaling pathway
    18708 (Pik3r1)
   04630 Jak-STAT signaling pathway
    18708 (Pik3r1)
   04668 TNF signaling pathway
    18708 (Pik3r1)
   04066 HIF-1 signaling pathway
    18708 (Pik3r1)
   04068 FoxO signaling pathway
    18708 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    18708 (Pik3r1)
   04072 Phospholipase D signaling pathway
    18708 (Pik3r1)
   04071 Sphingolipid signaling pathway
    18708 (Pik3r1)
   04024 cAMP signaling pathway
    18708 (Pik3r1)
   04022 cGMP - PKG signaling pathway
    18708 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    18708 (Pik3r1)
   04152 AMPK signaling pathway
    18708 (Pik3r1)
   04150 mTOR signaling pathway
    18708 (Pik3r1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    18708 (Pik3r1)
  Cell growth and death
   04210 Apoptosis
    18708 (Pik3r1)
  Cellular commiunity
   04510 Focal adhesion
    18708 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    18708 (Pik3r1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18708 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    18708 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    18708 (Pik3r1)
   04660 T cell receptor signaling pathway
    18708 (Pik3r1)
   04662 B cell receptor signaling pathway
    18708 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    18708 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    18708 (Pik3r1)
   04670 Leukocyte transendothelial migration
    18708 (Pik3r1)
   04062 Chemokine signaling pathway
    18708 (Pik3r1)
  Endocrine system
   04910 Insulin signaling pathway
    18708 (Pik3r1)
   04923 Regulation of lipolysis in adipocyte
    18708 (Pik3r1)
   04915 Estrogen signaling pathway
    18708 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    18708 (Pik3r1)
   04917 Prolactin signaling pathway
    18708 (Pik3r1)
   04921 Oxytocin signaling pathway
    18708 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    18708 (Pik3r1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18708 (Pik3r1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    18708 (Pik3r1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18708 (Pik3r1)
  Nervous system
   04725 Cholinergic synapse
    18708 (Pik3r1)
   04722 Neurotrophin signaling pathway
    18708 (Pik3r1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18708 (Pik3r1)
  Development
   04360 Axon guidance
    18708 (Pik3r1)
   04380 Osteoclast differentiation
    18708 (Pik3r1)
  Aging
   04211 Longevity regulating pathway - mammal
    18708 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    18708 (Pik3r1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18708 (Pik3r1)
   05230 Central carbon metabolism in cancer
    18708 (Pik3r1)
   05231 Choline metabolism in cancer
    18708 (Pik3r1)
   05205 Proteoglycans in cancer
    18708 (Pik3r1)
   05203 Viral carcinogenesis
    18708 (Pik3r1)
   05210 Colorectal cancer
    18708 (Pik3r1)
   05212 Pancreatic cancer
    18708 (Pik3r1)
   05214 Glioma
    18708 (Pik3r1)
   05221 Acute myeloid leukemia
    18708 (Pik3r1)
   05220 Chronic myeloid leukemia
    18708 (Pik3r1)
   05218 Melanoma
    18708 (Pik3r1)
   05211 Renal cell carcinoma
    18708 (Pik3r1)
   05215 Prostate cancer
    18708 (Pik3r1)
   05213 Endometrial cancer
    18708 (Pik3r1)
   05222 Small cell lung cancer
    18708 (Pik3r1)
   05223 Non-small cell lung cancer
    18708 (Pik3r1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    18708 (Pik3r1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    18708 (Pik3r1)
   04931 Insulin resistance
    18708 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18708 (Pik3r1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    18708 (Pik3r1)
   05166 HTLV-I infection
    18708 (Pik3r1)
   05162 Measles
    18708 (Pik3r1)
   05164 Influenza A
    18708 (Pik3r1)
   05161 Hepatitis B
    18708 (Pik3r1)
   05160 Hepatitis C
    18708 (Pik3r1)
   05169 Epstein-Barr virus infection
    18708 (Pik3r1)
   05146 Amoebiasis
    18708 (Pik3r1)
   05145 Toxoplasmosis
    18708 (Pik3r1)
   05142 Chagas disease (American trypanosomiasis)
    18708 (Pik3r1)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    18708 (Pik3r1)
   01524 Platinum drug resistance
    18708 (Pik3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 D1; 13 53.92 cM
AA seq 724 aa AA seqDB search
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQALPLPDLAE
QFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQLLKKLIRLPNIPHQCWLTL
QYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNE
RQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagagggctaccagtacagagcactgtacgactacaagaaggagcgagaggaa
gacattgacctacacctgggggacatactgactgtgaataaaggctccttagtggcactt
ggattcagtgatggccaggaagcccggcctgaagatattggctggttaaatggctacaat
gaaaccactggggagaggggagactttccaggaacttacgttgaatacattggaaggaaa
agaatttcaccccctactcccaagcctcggccccctcgaccgcttcctgttgctccgggt
tcttcaaaaactgaagctgacacggagcagcaagcgttgccccttcctgacctggccgag
cagtttgcccctcctgatgttgccccgcctctccttataaagctcctggaagccattgag
aagaaaggactggaatgttcgactctatacagaacacaaagctccagcaaccctgcagaa
ttacgacagcttcttgattgtgatgccgcgtcagtggacttggagatgatcgacgtacac
gtcttagcagatgctttcaaacgctatctcgccgacttaccaaatcctgtcattcctgta
gctgtttacaatgagatgatgtctttagcccaagaactacagagccctgaagactgcatc
cagctgttgaagaagctcattagattgcctaatatacctcatcagtgttggcttacgctt
cagtatttgctcaagcattttttcaagctctctcaagcctccagcaaaaaccttttgaat
gcaagagtcctctctgagattttcagccccgtgcttttcagatttccagccgccagctct
gataatactgaacacctcataaaagcgatagagattttaatctcaacggaatggaatgag
agacagccagcaccagcactgccccccaaaccacccaagcccactactgtagccaacaac
agcatgaacaacaatatgtccttgcaggatgctgaatggtactggggagacatctcaagg
gaagaagtgaatgaaaaactccgagacactgctgatgggacctttttggtacgagacgca
tctactaaaatgcacggcgattacactcttacactaaggaaaggaggaaataacaaatta
atcaaaatctttcaccgtgatggaaaatatggcttctctgatccattaaccttcaactct
gtggttgagttaataaaccactaccggaatgagtctttagctcagtacaaccccaagctg
gatgtgaagttgctctacccagtgtccaaataccagcaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataatactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggagtacacccgtacttcccaggaaatccaaatgaaa
agaacggctatcgaagcatttaatgaaaccataaaaatatttgaagaacaatgccaaacc
caggagcggtacagcaaagaatacatagagaagtttaaacgcgaaggcaacgagaaagaa
attcaaaggattatgcataaccatgataagctgaagtcgcgtatcagtgagatcattgac
agtaggaggaggttggaagaagacttgaagaagcaggcagctgagtaccgagagatcgac
aaacgcatgaacagtattaagccggacctcatccagttgagaaagacaagagaccaatac
ttgatgtggctgacgcagaaaggtgtgcggcagaagaagctgaacgagtggctggggaat
gaaaataccgaagatcaatactccctggtagaagatgatgaggatttgccccaccatgac
gagaagacgtggaatgtcgggagcagcaaccgaaacaaagcggagaacctattgcgaggg
aagcgagacggcactttccttgtccgggagagcagtaagcagggctgctatgcctgctcc
gtagtggtagacggcgaagtcaagcattgcgtcattaacaagactgccaccggctatggc
tttgccgagccctacaacctgtacagctccctgaaggagctggtgctacattatcaacac
acctccctcgtgcagcacaatgactccctcaatgtcacactagcatacccagtatatgca
caacagaggcgatga

DBGET integrated database retrieval system