KEGG   Mus musculus (mouse): 18708Help
Entry
18708             CDS       T01002                                 

Gene name
Pik3r1, PI3K, p50alpha, p55alpha, p85alpha
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04973  Carbohydrate digestion and absorption
mmu05100  Bacterial invasion of epithelial cells
mmu05142  Chagas disease (American trypanosomiasis)
mmu05146  Amoebiasis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    18708 (Pik3r1)
   04015 Rap1 signaling pathway
    18708 (Pik3r1)
   04012 ErbB signaling pathway
    18708 (Pik3r1)
   04370 VEGF signaling pathway
    18708 (Pik3r1)
   04630 Jak-STAT signaling pathway
    18708 (Pik3r1)
   04668 TNF signaling pathway
    18708 (Pik3r1)
   04066 HIF-1 signaling pathway
    18708 (Pik3r1)
   04068 FoxO signaling pathway
    18708 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    18708 (Pik3r1)
   04072 Phospholipase D signaling pathway
    18708 (Pik3r1)
   04071 Sphingolipid signaling pathway
    18708 (Pik3r1)
   04024 cAMP signaling pathway
    18708 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    18708 (Pik3r1)
   04152 AMPK signaling pathway
    18708 (Pik3r1)
   04150 mTOR signaling pathway
    18708 (Pik3r1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    18708 (Pik3r1)
  Cell growth and death
   04210 Apoptosis
    18708 (Pik3r1)
   04218 Cellular senescence
    18708 (Pik3r1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    18708 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    18708 (Pik3r1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    18708 (Pik3r1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18708 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    18708 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    18708 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    18708 (Pik3r1)
   04660 T cell receptor signaling pathway
    18708 (Pik3r1)
   04662 B cell receptor signaling pathway
    18708 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    18708 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    18708 (Pik3r1)
   04670 Leukocyte transendothelial migration
    18708 (Pik3r1)
   04062 Chemokine signaling pathway
    18708 (Pik3r1)
  Endocrine system
   04910 Insulin signaling pathway
    18708 (Pik3r1)
   04923 Regulation of lipolysis in adipocyte
    18708 (Pik3r1)
   04915 Estrogen signaling pathway
    18708 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    18708 (Pik3r1)
   04917 Prolactin signaling pathway
    18708 (Pik3r1)
   04926 Relaxin signaling pathway
    18708 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    18708 (Pik3r1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    18708 (Pik3r1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18708 (Pik3r1)
  Nervous system
   04725 Cholinergic synapse
    18708 (Pik3r1)
   04722 Neurotrophin signaling pathway
    18708 (Pik3r1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18708 (Pik3r1)
  Development
   04360 Axon guidance
    18708 (Pik3r1)
   04380 Osteoclast differentiation
    18708 (Pik3r1)
  Aging
   04211 Longevity regulating pathway - mammal
    18708 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    18708 (Pik3r1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18708 (Pik3r1)
   05230 Central carbon metabolism in cancer
    18708 (Pik3r1)
   05231 Choline metabolism in cancer
    18708 (Pik3r1)
   05205 Proteoglycans in cancer
    18708 (Pik3r1)
   05203 Viral carcinogenesis
    18708 (Pik3r1)
   05210 Colorectal cancer
    18708 (Pik3r1)
   05212 Pancreatic cancer
    18708 (Pik3r1)
   05225 Hepatocellular carcinoma
    18708 (Pik3r1)
   05226 Gastric cancer
    18708 (Pik3r1)
   05214 Glioma
    18708 (Pik3r1)
   05221 Acute myeloid leukemia
    18708 (Pik3r1)
   05220 Chronic myeloid leukemia
    18708 (Pik3r1)
   05218 Melanoma
    18708 (Pik3r1)
   05211 Renal cell carcinoma
    18708 (Pik3r1)
   05215 Prostate cancer
    18708 (Pik3r1)
   05213 Endometrial cancer
    18708 (Pik3r1)
   05224 Breast cancer
    18708 (Pik3r1)
   05222 Small cell lung cancer
    18708 (Pik3r1)
   05223 Non-small cell lung cancer
    18708 (Pik3r1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    18708 (Pik3r1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    18708 (Pik3r1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    18708 (Pik3r1)
   04931 Insulin resistance
    18708 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18708 (Pik3r1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    18708 (Pik3r1)
   05166 HTLV-I infection
    18708 (Pik3r1)
   05162 Measles
    18708 (Pik3r1)
   05164 Influenza A
    18708 (Pik3r1)
   05161 Hepatitis B
    18708 (Pik3r1)
   05160 Hepatitis C
    18708 (Pik3r1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    18708 (Pik3r1)
   05169 Epstein-Barr virus infection
    18708 (Pik3r1)
   05165 Human papillomavirus infection
    18708 (Pik3r1)
   05146 Amoebiasis
    18708 (Pik3r1)
   05142 Chagas disease (American trypanosomiasis)
    18708 (Pik3r1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    18708 (Pik3r1)
   01524 Platinum drug resistance
    18708 (Pik3r1)
   01522 Endocrine resistance
    18708 (Pik3r1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    18708 (Pik3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I Mod_r Lant_dehydr_C DUF4201 Transcrip_act
Motif
Other DBs
NCBI-GeneID: 18708
NCBI-ProteinID: NP_001070963
MGI: 97583
Ensembl: ENSMUSG00000041417
Vega: OTTMUSG00000048150
UniProt: P26450 Q8C7P2 Q3TP23
Position
13 D1; 13 53.92 cM
AA seq 724 aa AA seqDB search
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQALPLPDLAE
QFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQLLKKLIRLPNIPHQCWLTL
QYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNE
RQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagagggctaccagtacagagcactgtacgactacaagaaggagcgagaggaa
gacattgacctacacctgggggacatactgactgtgaataaaggctccttagtggcactt
ggattcagtgatggccaggaagcccggcctgaagatattggctggttaaatggctacaat
gaaaccactggggagaggggagactttccaggaacttacgttgaatacattggaaggaaa
agaatttcaccccctactcccaagcctcggccccctcgaccgcttcctgttgctccgggt
tcttcaaaaactgaagctgacacggagcagcaagcgttgccccttcctgacctggccgag
cagtttgcccctcctgatgttgccccgcctctccttataaagctcctggaagccattgag
aagaaaggactggaatgttcgactctatacagaacacaaagctccagcaaccctgcagaa
ttacgacagcttcttgattgtgatgccgcgtcagtggacttggagatgatcgacgtacac
gtcttagcagatgctttcaaacgctatctcgccgacttaccaaatcctgtcattcctgta
gctgtttacaatgagatgatgtctttagcccaagaactacagagccctgaagactgcatc
cagctgttgaagaagctcattagattgcctaatatacctcatcagtgttggcttacgctt
cagtatttgctcaagcattttttcaagctctctcaagcctccagcaaaaaccttttgaat
gcaagagtcctctctgagattttcagccccgtgcttttcagatttccagccgccagctct
gataatactgaacacctcataaaagcgatagagattttaatctcaacggaatggaatgag
agacagccagcaccagcactgccccccaaaccacccaagcccactactgtagccaacaac
agcatgaacaacaatatgtccttgcaggatgctgaatggtactggggagacatctcaagg
gaagaagtgaatgaaaaactccgagacactgctgatgggacctttttggtacgagacgca
tctactaaaatgcacggcgattacactcttacactaaggaaaggaggaaataacaaatta
atcaaaatctttcaccgtgatggaaaatatggcttctctgatccattaaccttcaactct
gtggttgagttaataaaccactaccggaatgagtctttagctcagtacaaccccaagctg
gatgtgaagttgctctacccagtgtccaaataccagcaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataatactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggagtacacccgtacttcccaggaaatccaaatgaaa
agaacggctatcgaagcatttaatgaaaccataaaaatatttgaagaacaatgccaaacc
caggagcggtacagcaaagaatacatagagaagtttaaacgcgaaggcaacgagaaagaa
attcaaaggattatgcataaccatgataagctgaagtcgcgtatcagtgagatcattgac
agtaggaggaggttggaagaagacttgaagaagcaggcagctgagtaccgagagatcgac
aaacgcatgaacagtattaagccggacctcatccagttgagaaagacaagagaccaatac
ttgatgtggctgacgcagaaaggtgtgcggcagaagaagctgaacgagtggctggggaat
gaaaataccgaagatcaatactccctggtagaagatgatgaggatttgccccaccatgac
gagaagacgtggaatgtcgggagcagcaaccgaaacaaagcggagaacctattgcgaggg
aagcgagacggcactttccttgtccgggagagcagtaagcagggctgctatgcctgctcc
gtagtggtagacggcgaagtcaagcattgcgtcattaacaagactgccaccggctatggc
tttgccgagccctacaacctgtacagctccctgaaggagctggtgctacattatcaacac
acctccctcgtgcagcacaatgactccctcaatgtcacactagcatacccagtatatgca
caacagaggcgatga

DBGET integrated database retrieval system