KEGG   Mus musculus (mouse): 18797Help
Entry
18797             CDS       T01002                                 

Gene name
Plcb3, mKIAA4098
Definition
phospholipase C, beta 3 (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18797 (Plcb3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    18797 (Plcb3)
   04310 Wnt signaling pathway
    18797 (Plcb3)
   04020 Calcium signaling pathway
    18797 (Plcb3)
   04070 Phosphatidylinositol signaling system
    18797 (Plcb3)
   04022 cGMP - PKG signaling pathway
    18797 (Plcb3)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    18797 (Plcb3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18797 (Plcb3)
   04062 Chemokine signaling pathway
    18797 (Plcb3)
  Endocrine system
   04911 Insulin secretion
    18797 (Plcb3)
   04912 GnRH signaling pathway
    18797 (Plcb3)
   04915 Estrogen signaling pathway
    18797 (Plcb3)
   04921 Oxytocin signaling pathway
    18797 (Plcb3)
   04918 Thyroid hormone synthesis
    18797 (Plcb3)
   04919 Thyroid hormone signaling pathway
    18797 (Plcb3)
   04916 Melanogenesis
    18797 (Plcb3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18797 (Plcb3)
   04270 Vascular smooth muscle contraction
    18797 (Plcb3)
  Digestive system
   04970 Salivary secretion
    18797 (Plcb3)
   04971 Gastric acid secretion
    18797 (Plcb3)
   04972 Pancreatic secretion
    18797 (Plcb3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    18797 (Plcb3)
  Nervous system
   04724 Glutamatergic synapse
    18797 (Plcb3)
   04725 Cholinergic synapse
    18797 (Plcb3)
   04728 Dopaminergic synapse
    18797 (Plcb3)
   04726 Serotonergic synapse
    18797 (Plcb3)
   04720 Long-term potentiation
    18797 (Plcb3)
   04730 Long-term depression
    18797 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    18797 (Plcb3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18797 (Plcb3)
  Environmental adaptation
   04713 Circadian entrainment
    18797 (Plcb3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    18797 (Plcb3)
   05016 Huntington's disease
    18797 (Plcb3)
  Infectious diseases
   05146 Amoebiasis
    18797 (Plcb3)
   05142 Chagas disease (American trypanosomiasis)
    18797 (Plcb3)
   05143 African trypanosomiasis
    18797 (Plcb3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18797 (Plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 B; 19 5.1 cM
AA seq 1234 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFPLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARLLIEKYETNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGPSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAEAAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLSAGIPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKTSLEPQKSLGE
ESLSREPNVPMPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDKKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTETYQETPCQQ
PGSQLPSNPTPNPLDASPRWPPGPTTSSTSSSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMVKLRSRQDRDLRELHKKHQRKAVALTRRLLDGLAQARAEGKCRPSPSALGKATNSE
DVKEEEEAKQYREFQNRQVQSLLELREAQADVETKRKLEHLRQAHQRLKEVVLDTHTTQF
KRLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRRLE
EAQKQRHERLVAGQQQVLQQLEEEEPKLLAQLTQECQEQRERLPQEIRRCLLGETAEGLG
DGPLVACASNGHAPGSGGHLSSADSESQEENTQL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgtgtggaccctaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgcctg
cccaaggaccctaagattcgagaagtactgggctttggaggtcctgacacccggctggag
gagaaactgatgacagtggtggccgggccagatccagtaaataccacattcttgaacttc
atggccgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaaactggccatg
aacatattggctcagaacgcctcccggaacaccttcctgcggaaagcatacacgaagctg
aagctgcaggtgaaccaggatggacggattccggtcaagaacattctgaagatgttctcg
gcggacaagaagcgggtggagacggcgctggagtcctgtggcctcaacttcaaccgaagt
gagtccattcgccctgatgagtttcccttggaaatttttgagcggttcttgaataaactg
tgtctgcgcccggatattgacaagatcctgctggagataggtgccaagggcaagccgtac
ctcactctggagcagctcatggactttatcaaccagaagcagagagacccgagactcaac
gaagtgctgtacccgccacttcggtcctcacaggctcggctgctcattgagaagtacgag
acgaacaaacagttcctggagcgcgaccagatgtctatggagggcttcagccgctacctg
ggaggggaggagaatggtatcctgcctctggaggccctggatctgagcatggacatgacc
cagccactgagcgcatattttatcaactcctcacacaacacctatctcactgcgggccag
ctggctggaccatcatcggtggagatgtaccgccaggcactgctgtggggctgccgctgt
gtggagctggatgtatggaagggacggccaccggaggaagagcctttcatcactcatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgctagaggccatcgctgaggcagcc
ttcaagacctcgccctaccctgtcatcctctcctttgagaaccatgtcgactcggcaaag
cagcaggccaagatggctgagtactgccgctctatctttggggatgcgctgctcattgac
cctctcgacaaatacccgctatctgcgggcatccccctgcctagtccacaggacctgatg
ggccgtatcctggtgaagaataagaagcgacatcggcccagcacaggtgtccctgacagc
tcagtgcgcaagcggcctctggaacagagcaactcggccttgagtgagagctcggccgcc
acagagccctcctcacctcagcttgggtcccccagctccgacagctgccctggcctaagc
aatggggaggaggtgggactcgagaagaccagcctggagcctcagaagtctctaggtgag
gagagcctcagccgggaacctaatgtgcccatgcctgaccgtgaccgagaggatgaggag
gaagatgaagaagaagaggaaacaacggatccaaaaaagcccaccactgatgagggcaca
gccagcagtgaggtcaatgccacggaggagatgtcaacgctcgtcaactacgttgagccc
gtcaagttcaagtccttcgaggctgctcgaaaaaggaacaagtgcttcgagatgtcatcc
ttcgtggagaccaaggcaatggagcaactgaccaagagtcctatggagtttgtggaatac
aacaaacagcagctcagccgcatctaccctaagggcacacgagtggactcctccaactac
atgcctcagctcttctggaacgtgggttgccagcttgttgccctcaacttccagaccttg
gatttgccaatgcagctcaacgcaggcgtgtttgagtacaatgggcgcagcgggtacttg
ctcaagcccgagtttatgcggcggccggacaagtcttttgatcccttcactgaggtcatc
gtagatggcatagtggccaacgccttgcgggtcaaggtgatttcggggcagttcctgtct
gacaagaaggtgggcatctacgtcgaggtggacatgtttggcctcccagttgacacaaga
cgcaaatatcgtacccggacatcccaggggaactcattcaaccctgtgtgggacgaggaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcacttcgcatcgcagccttt
gaggagggtggcaaatttgttgggcaccgtatcctgcctgtctctgctatccgctcagga
taccactatgtctgcctgcgaaacgaggccaaccaacctttgtgcctgcctgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
attaaccccatcaagcacgtaagcctaatggaccagcgggccaagcaactagccgctctc
attggggagagtgaggctcaggccagcacagagacatatcaggagaccccgtgtcaacag
ccagggtcacagctcccctccaaccccacacctaacccactggatgcctcacctcgctgg
ccccccggtcctaccacttcctccactagctcctccctcagtagcccagggcagcgagat
gatttgattgccagcatcctctctgaggtgacccctacacctctagaggagctcagaagc
cacaaggctatggtgaagctacggagccggcaggatcgagacctgcgggagttgcataag
aagcaccagcgcaaggctgtggccctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcccccagtgccctgggcaaggccaccaactcggag
gacgtgaaggaggaagaggaggccaaacagtatcgagagttccagaaccgacaagtacag
agcctgttggagctgagggaagcccaggcagatgtggagaccaagcggaagctggagcat
ctacgacaggctcatcagcggctcaaggaggttgtcctggatacacacacaacacagttc
aagaggctgaaggagctgaatgaaagggagaagaaggaactccagaagatcctggacagg
aagcgcaacaacagcatctcagaggccaagacaagggagaaacacaagaaggaggtggaa
ctgacagagattaatcggcggcacatcactgagtcggtaaactccatcagacggctggaa
gaggcccagaagcagcgccatgaacgcctggtggcagggcaacagcaagtcctccagcag
ctagaggaagaggaacccaagctgctggcccagctgacccaggagtgtcaggaacagcga
gagaggttgccccaggagatccgtcggtgcctgctgggcgagacagcagagggactgggg
gacggccccctggtggcctgtgccagcaatggtcatgcacctgggagtggtgggcacctg
tccagcgctgactcggagagccaggaggagaacacccagctttga

DBGET integrated database retrieval system