KEGG   Mus musculus (mouse): 18798Help
Entry
18798             CDS       T01002                                 

Gene name
Plcb4, A930039J07Rik, AI854601, C230058B11Rik
Definition
(RefSeq) phospholipase C, beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing's syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer's disease
mmu05016  Huntington's disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05200  Pathways in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18798 (Plcb4)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    18798 (Plcb4)
   04310 Wnt signaling pathway
    18798 (Plcb4)
   04371 Apelin signaling pathway
    18798 (Plcb4)
   04020 Calcium signaling pathway
    18798 (Plcb4)
   04070 Phosphatidylinositol signaling system
    18798 (Plcb4)
   04072 Phospholipase D signaling pathway
    18798 (Plcb4)
   04071 Sphingolipid signaling pathway
    18798 (Plcb4)
   04022 cGMP - PKG signaling pathway
    18798 (Plcb4)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    18798 (Plcb4)
 Organismal Systems
  Immune system
   04611 Platelet activation
    18798 (Plcb4)
   04621 NOD-like receptor signaling pathway
    18798 (Plcb4)
   04062 Chemokine signaling pathway
    18798 (Plcb4)
  Endocrine system
   04911 Insulin secretion
    18798 (Plcb4)
   04922 Glucagon signaling pathway
    18798 (Plcb4)
   04912 GnRH signaling pathway
    18798 (Plcb4)
   04915 Estrogen signaling pathway
    18798 (Plcb4)
   04921 Oxytocin signaling pathway
    18798 (Plcb4)
   04926 Relaxin signaling pathway
    18798 (Plcb4)
   04918 Thyroid hormone synthesis
    18798 (Plcb4)
   04919 Thyroid hormone signaling pathway
    18798 (Plcb4)
   04928 Parathyroid hormone synthesis, secretion and action
    18798 (Plcb4)
   04916 Melanogenesis
    18798 (Plcb4)
   04924 Renin secretion
    18798 (Plcb4)
   04925 Aldosterone synthesis and secretion
    18798 (Plcb4)
   04927 Cortisol synthesis and secretion
    18798 (Plcb4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18798 (Plcb4)
   04270 Vascular smooth muscle contraction
    18798 (Plcb4)
  Digestive system
   04970 Salivary secretion
    18798 (Plcb4)
   04971 Gastric acid secretion
    18798 (Plcb4)
   04972 Pancreatic secretion
    18798 (Plcb4)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    18798 (Plcb4)
  Nervous system
   04724 Glutamatergic synapse
    18798 (Plcb4)
   04725 Cholinergic synapse
    18798 (Plcb4)
   04728 Dopaminergic synapse
    18798 (Plcb4)
   04726 Serotonergic synapse
    18798 (Plcb4)
   04720 Long-term potentiation
    18798 (Plcb4)
   04730 Long-term depression
    18798 (Plcb4)
   04723 Retrograde endocannabinoid signaling
    18798 (Plcb4)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18798 (Plcb4)
  Environmental adaptation
   04713 Circadian entrainment
    18798 (Plcb4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    18798 (Plcb4)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    18798 (Plcb4)
   05016 Huntington's disease
    18798 (Plcb4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    18798 (Plcb4)
   04934 Cushing's syndrome
    18798 (Plcb4)
  Infectious diseases
   05146 Amoebiasis
    18798 (Plcb4)
   05142 Chagas disease (American trypanosomiasis)
    18798 (Plcb4)
   05143 African trypanosomiasis
    18798 (Plcb4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18798 (Plcb4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18798 (Plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18798 (Plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 18798
NCBI-ProteinID: NP_001342082
MGI: 107464
Ensembl: ENSMUSG00000039943
Vega: OTTMUSG00000015959
Position
2 F3; 2 66.64 cM
AA seq 1194 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPASILEDDNEEEIESADQEEEAHPEYKFGNELSADDYSHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTAA
LGSGQEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEIKKETEIKIQTLTTDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQSAN
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttacgaatttaactggcagaaggaagtgccctctttcttgcaagaagga
gcagtttttgacagatacgaagaggaatcttttgtgtttgagcccaactgcctcttcaaa
gtagatgaattcggcttcttcctgacgtggaagagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagtattcgccaagcagccataccaaaggatcccaaaatcctg
gctgctctcgaagctgttggaaaatctgaaaatgatctggaagggcggatattgtgtgtc
tgcagcggcacggatctggtgaatatcggcttcacttacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcgatcattcacaacttcagggcaaacaac
gtcagtccgatgacatgcctcaagaaacactggatgaaactggcctttctgaccaacaca
actggtaaaatcccagtgaggagtatcactagaaccttcgcatcagggaaaacagaaaag
gtgatctttcaagccctcaaggaactaggtcttcccagtggaaagaatgatgaaattgaa
cctgctgcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaacgaacatcagcgagatcctcggctgaatgaaattttattc
ccattttatgatgctaaaagagcaatgcagatcattgaaatgtatgagcctgatgaagag
ctgaagaaaaaaggcctcatatccagtgatggattctgcagatatctgatgtcagatgaa
aatgcccctgtcttcttagatcgcttagaactttaccaggagatggaccacccgctggct
cattacttcatcagttcctcccacaacacctatctcactggccggcaatttggaggaaag
tcttcagtggaaatgtacagacaagttctcctggctggttgcaggtgtgttgaacttgac
tgttgggatggaaaaggtgaagatcaggaaccgataataactcacggaaaagcaatgtgt
acagacatcctttttaaggatgtaatccaggccatcaaggaaacggcgtttgtcacatca
gaataccctgtcattctctccttcgaaaaccactgcagcaaatatcaacagtacaagatg
tccaagtattgtgaagatctatttggggatctcctgttgaaacaagcacttgagtcgcat
ccacttgaaccaggaaggcccttgccgtctcctaatgacctcaaaagaaaaatactcatc
aagaataagaggctgaagcctgaagttgaaaagaaacagcttgaagctttgaaaagcatg
atggaagctggagagtcagccgccccagctagcatcttggaagacgacaatgaagaggaa
atagaaagtgctgatcaagaggaagaagcccaccctgaatacaaatttggaaatgaactt
tctgccgatgactacagtcacaaggaagcggttgcaaacagcgtcaagaagggcctggtc
accgtagaggatgagcaagcatggatggcatcttataaatacgtaggtgctaccacgaac
atccatccgtacttgtccacgatgatcaactatgcccagcccgtgaagtttcaaggtttc
cacgtggctgaagagcgcaatattcactataacatgtcttcttttaacgagtcggttggc
cttggctacttgaagacgcacgcgattgagtttgtaaattacaataagcgacaaatgagc
cgcatttaccccaagggaggccgagttgattccagtaattacatgcctcagattttctgg
aacgctggttgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcaaggaaaatttgagtataatggatcatgcgggtaccttctcaagccagatttcatg
aggcggcctgatcggacatttgaccccttctctgaaacccctgtggacggggttattgca
gccacgtgctcagtgcaggttatatcagggcagttcctctcagataagaagatcgggaca
tacgtggaagtcgatatgtacgggctgcccaccgacaccatacggaaagagttccgaacc
cgcatggttatgaacaatggactcaacccagtgtataatgaagaatcgtttgtgtttcga
aaggtgatcctgcctgacctagctgtcctgagaatcgcagtctacgatgacaacaacaag
ctaattggccagaggatccttcctttggatggtctccaagcaggctaccgacacatctcc
ctgagaaacgagggaaacaaaccattatcactgccaacaattttctgcaatattgttctt
aaaacatacgtgcctgatggatttggagatattgtggatgctttatccgatccaaagaaa
tttctttcaatcacagagaagagagcagaccaaatgagagcaatgggcattgaaactagt
gacatagcagatgtgcccagtgacacttccaaaaatgacaagaaaggcaaggccaaccca
gccaaagcgaacgtgacccctcagagcagctctgagctcagaccaaccaccacagccgcc
ctgggctctggccaggaagccaagaaaggtattgaacttatccctcaagtgaggatagaa
gatttaaagcaaatgaaggcttacttgaagcatttaaagaaacaacagaaggagttaaac
tctttaaagaagaaacatgcaaaggagcacagtaccatgcagaagttacactgcacacaa
gttgacaaaatcgtggcccagtatgacaaagagaagtcgactcatgagaaaatcctagag
aaggcgatgaagaagaaggggggaagtaattgtcttgaaataaaaaaagaaacagaaatt
aaaattcagaccctgacaacggatcacaaatctaaggtcaaagagattgtggcccagcac
acaaaggagtggtcagaaatgatcaacactcacagtgcggaggagcaggaaatccgggat
ctgcacctgagccagcagtgtgagctgctgagaaagctgctcatcaatgctcatgagcag
cagacccagcagctgaaactctcccatgacagggaaagcaaggagatgagagcccatcag
gctaagatttctatggaaaatagcaaggccatcagtcaagataaatctatcaagaacaag
gcagaacgggaaaggcgagtcagggagttgaacagcagcaacactaagaagttcctagaa
gaaagaaagagactggcgatgaagcagtcaaaagaaatggatcagttgaaaaaagtccag
ctggagcacctagaattcctagagaaacagaacgagcagcttttgaaatcctgtcatgca
gtgtcccaaacacaaggcgaaggagatgcagcagatggtgaaattggaagccgagatgga
ccgcagaccagcaacagtagtatgaaactccagagtgcaaactga

DBGET integrated database retrieval system