KEGG   Mus musculus (mouse): 18799Help
Entry
18799             CDS       T01002                                 

Gene name
Plcd1, AW212592, C79986
Definition
phospholipase C, delta 1 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18799 (Plcd1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    18799 (Plcd1)
   04070 Phosphatidylinositol signaling system
    18799 (Plcd1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    18799 (Plcd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18799 (Plcd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F3; 9
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
SPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADVQH
WVQGLRKIIDRSGSMDQRQKLQHWIHSCLRKADKNKDNKMNFKEVKDFLKELNVQVDDSY
ARKIFRECDHSQTDSLEDEEIETFYRMLTQRAEIDRAFAEAAGSAETLSVEKLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMNQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMAHHLRAILGPMLLDQPLDG
VTTSLPSPEQLKEKILLKGKKLGGLLPAGGENGPEATDVSDEDEAAEMEDEAVRSQVQHK
PKEDKLKLVPELSDMVIYCKSVHFGGFSSPSTSGQAFYEMASFSESRALRLLQESGNSFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCG
YVLKPAFLRDPDTTFNSRALTQGPWWAPKKLRVWIISGQQLPKVNKNKNSIVDPKVIVEI
HGVGQDVASRQTAVITNNGFNPRWDTEFEFVVAVPDLALVRFMVEDYDSSSKNDFIGQST
IPWNSLKQGYRHVHLLSKNGDLHPSATLFVKISIQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactccggtcgggacttcctgaccttgcacgggctgcaggatgacccggaccttcag
gccctcctgaagggcagccagcttctgaaggtgaagtccagctcgtggcgtagagaacgc
ttctacaagctacaggaggactgcaagaccatctggcaggaatctcgcaaggtcatgagg
tccccggagtcgcagctgttctccatcgaggacattcaggaggtgcggatgggacaccgc
acagaaggcctggagaaatttgccagagacatacccgaggaccgatgcttctccatcgtc
ttcaaggaccagcgcaataccctagacctcatcgccccgtctccagctgacgtccagcat
tgggtgcagggcctgcgcaagatcatcgaccgctcgggctccatggaccagcggcagaag
ctgcagcactggattcactcctgcttgcgaaaggctgataaaaacaaggataacaagatg
aacttcaaggaggtgaaggacttcctgaaggagctcaacgtacaggtggatgacagctac
gccaggaagatcttcagggaatgtgaccactcccagacagactcgctggaggatgaggag
attgagaccttctacaggatgctgacccagcgggcagagatcgaccgtgcctttgcagag
gccgcaggttctgcggagaccctgtcggtggagaagctagtgacgttcctgcagcatcag
cagcgggaggaggaggcggggccagccttggccctctctctcattgagcgctacgagccc
agtgagactgccaaagcccagcggcagatgaccaaggatggcttcctcatgtacctgctg
tctgctgacggtaacgccttcagcctggcgcaccgccgtgtctaccaggacatgaaccag
ccgctcagccactacttagtgtcttcttcccacaacacctacctactggaggaccagctc
acagggcccagcagcacggaggcctacatccgggctctgtgcaaaggctgccggtgtctg
gagctggactgctgggacggccccaaccaggaacccatcatctaccatggctacactttt
acctctaagatacttttctgcgacgtgctcagggccatccgggactacgccttcaaggca
tccccctacccagttatcctgtccctggagaaccactgcagcctggagcaacaacgagtc
atggctcatcacctgagggccatcctggggcccatgctgttggaccagccgctggatggg
gttaccacgagcctgccttcgcctgagcaactgaaggaaaagattctgttgaaagggaag
aaactgggcgggctgctacctgctggaggggaaaacgggcctgaagccaccgatgtgtct
gacgaagatgaggctgctgaaatggaagatgaggccgtgcgcagccaagtgcaacacaag
cccaaggaggataagctaaagctggtgccggagctctccgacatggtcatttactgcaag
agtgtccactttggtggcttctccagtcctagcacctctgggcaggcattctatgagatg
gcttccttctccgagagccgtgccctgcggctgctgcaagaatcaggaaatagttttgtc
cgccataacgtgggccatctgagcaggatctacccagctgggtggaggacagattcctcc
aactacagtcccgtggagatgtggaatggaggctgccagattgtggctctgaacttccaa
acccctgggccagaaatggatgtttaccttggctgcttccaggacaatggaggttgtggg
tatgtgctgaaaccggccttcctgagagaccctgacaccaccttcaactcacgggccctg
actcaggggccctggtgggccccgaagaagctccgagtctggatcatctctggacagcag
ctgccgaaggtcaataagaataagaattctatcgtggaccccaaggtgatagtggagatc
cacggtgtgggccaggatgtggccagccgtcagacagcagttattaccaataatggtttc
aacccacggtgggacacggagtttgagtttgtggtagcagtgcctgaccttgcccttgta
cgtttcatggtagaggattatgactcctcctctaagaacgactttatcggccagagtact
atcccctggaacagcctcaagcaggggtaccgccatgtccacctcttgtctaagaatgga
gacctgcatccatcagccactctctttgtgaagatctccatccaggactaa

DBGET integrated database retrieval system