KEGG   Mus musculus (mouse): 19090Help
Entry
19090             CDS       T01002                                 

Gene name
Prkdc, AI326420, AU019811, DNA-PKcs, DNAPDcs, DNAPK, DNPK1, DOXNPH, HYRC1, XRCC7, dxnph, p460, scid, slip
Definition
(RefSeq) protein kinase, DNA activated, catalytic polypeptide (EC:2.7.11.1)
  KO
K06642  
DNA-dependent protein kinase catalytic subunit [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Non-homologous end-joining
Cell cycle
Module
DNA-PK complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    19090 (Prkdc)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    19090 (Prkdc)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19090 (Prkdc)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   19090 (Prkdc)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    19090 (Prkdc)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     19090 (Prkdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 10.09 cM; 16 B1
AA seq 4128 aa AA seqDB search
MAEEGTGVRCWLLQLQEFLSAADRCSAAGASYQLIRSLGQECVLSTSSAVQALQISLVFS
RDFGLLVFIRKSLSIEDFRDCREEALKFLCVFLEKIDQKVMHYSLDIKNTCTSVYTKDRT
AKCKIPALDLLIKLLQILRSTRLMDEFKIGELFNKFYGELASKSKLPDTVLEKVYELLGV
LGEVHPSEMINHSENLFRAFLGELKTQMTSTVREPKFPVLAGCLKGLSSLLCNFTKSMEE
DPQTSKEIFGFTFKAIRPQIEMKRYAVPLAGLRLLTLHASQFTACLLDNYITLFEVLSKW
CSHTNVELKKAAHSALESFLRQISFTVAEDAELHKSRLKYFMEQFYGIIRNTDSNNKELA
IAIRGYGLFAGPCKVINAKDVDFMYVELIQRCKQMFLTHADASEDHVYQMPSFLQSIASV
LLYLDTVPEVYTPVLEHLMVVQIDSFPQYSPKMQLVCCKAIIKLFLALSEKGPVHWNCIS
AVVHQGLIRICSKPVVLQKDVESRSDNRSASEEVRTGRWKVPTYKDYVDLFQHLLGCDQM
EDFILGDETFLFVNSSLKSLNHLLYDEFIRSVLKIVEKLDLTLEKQTVGEQEDGSTADVW
VIPTSDPAANLHPAKPSDFSALINLVEFCREILPRKHVGFFEPWVYSFAYELILQSTRLP
LISGFYKLLSIAVKNARKIKYFEGISPKSLKHSPEDTEKYSCFALFAKFGKEVSVKMKQY
KDELLASCLTFVLSLPHDIIELDVRAYVPALQMAFKLGLSHMPLAEIGLHALKEWSVHID
KSILQPYYKDILPCLDGYLNTSTLSDETKSHWGLSALSRAAQKGFNRHVVKHLKRTRNSS
PDEALSLEEIRIKVVQILGSLGGQINKSLVTATSGERMKKYVAWDAERRLSFAVPFREMK
PVIYLDVFLPRVTELALSASDRQTKVAACELLHSMVMFMLGRATQMPEGQGLPPMYQLYK
HTFPVLLQLACDVDQVTRQLYEPLVMQLIHWLTNNKKFESQDTVALLEAILDGIVDPVDS
TLRDFCGRCVQEFLKWSIKQTTPQQQEKSPVNSKSLFKRLYSLALHPNAFKRLGAALAFN
HIYKEFREEGSLVEQFVFEALVTYMESLALAHEDEKSLGTVQQCCDAIDHLRRIIEKKHV
SLNKAKKRRLPQGFPPLTSLCLLDLVEWLLAHCGRPQTECRHKSMELFYKFVPLLPGNKS
PSLWLKDLIKKKGISFLINTFEGGASSSDQPAGILAQPTLVYLQGPISLRGVLQWLDLLL
AALECYNTFIEKETVQGQEVLGAEVQSSLLKSVAFFLESIATHSARAVEQRFGSGAPGPP
SLHEEEKYNYSKCTVLVRIMEFTTTLLIASPEDCKLLEKDLCNTNLMQVLVKMICEPMSL
GFNIGDVQVMNHLPSICVNLLKALRKSPYRDMLETHLKEKVTVQSVEELCSINLCSSGAR
QERSKLLSILSACKQLHKAGFSHVISPSQSTALNHSVGMRLLSLVYKGIVPAEERQCLQS
LDPSCKSLANGLLELAFGFGGLCDHLVSLLLNSAMLSTQYLGSSQRNISFSHGEYFYSLF
SEVINSELLKNLDIAVSRLMESSSDNPKMVSTVLNGMLDTSFRDRAVQKHQGLKLATAIL
QNWRKCDSWWAPDSAPESKTTVLSLLAKMLQIDSALSFDTNHSSFSEIFTTYASLLADTK
LGLHLKGQAIILLPFFTSLREGSLENLKHILEKLIVCNFPMKSDEFPPDSLKYNNYVDCM
KKFLDALELSQSPMLFQLMTDILCREQRHIMEELFQTTFKRIARQSPCVTQLNLLESVYT
MFRKADLPSNVTRQAFVDRSLLTLLWHCDLDTLKEFFSRIVVDAIDVLKSRFTKLNEFTF
DTQITKKMCYYKMLAVMYSRLLKDDVHSKEAKINQAFHGSRVAEGNELTKTLLKLCHDAF
TENMVGESQLLEKRRLYHCAAYNCAISLISCVFNELKFYQGFLFNEKPEKNLFIFENLID
LKRCYTFPIEVEVPMERKKKYIEIRKEARDAANGASGSPHYMSSLSYLTDSSLSEEMSQF
DFSTGVQSYSYSSQDRKPTTGHFQRREHQDSMTQDDIMELEMDELNQHECMAPMIALIKH
MQRNVIAPKGEEGSIPKDLPPWMKFLHDKLGNASVSLNIRLFLAKLVINTEEVFRPYAKH
WLSPLLQLAVCENNREGIHYMMVEIVATILSWTGLATPTGVPKDEVLANRLLRFLMKHVF
HPKRAVFRHNLEIIKTLVECWKECLSIPYRLIFEKFSHKDPNSKDNSVGIQLLGIVIANN
LPPYDPNCDITSAMYFEALVNNMSFVKYKEVYAAAAEVLGLILQYITERKHVIAELVCEL
VIKQLKQHQNTMEDKFIVCLNKIAKGFPPLADRFLNALFFLLPKFHGVMKTLCLEVVLCR
AEEITGLYLQLKSKDFLQVMRHRDDERQKVCLDIVYKMVAKLKPIELRELLNPVVEFVSH
PSPTCREQMYNILMWIHDNYRDQESQNDEDSQEIFKLAKDVLIQGLIDENVGLQLIIRNF
WSHETRLPSNTLDRLLALNSLYSPKIEVHFLSLATNFLLEMTRMSPDYLNPIFEHPLSEC
EFQEYTIDPDWRFRSTVLTPMFIETQASPSILHTQTQEGPLSDQRQKPGQVRATQQQYDF
TPTQASVERSSFDWLTGSSIDLLADHTVFSSETLSSSLLFSHKRTEKSQRMSCKSVGPDF
GTKKLGLPDDEVDNQVKSGTPSQADILRLRRRFLKDREKLSLLYAKRGLMEQKLEKDIKS
EFKMKQDAQVVLYRSYRHGDLPDIQIQHSGLITPLQAVAQKDPIIAKQLFSSLFSGILKE
MNKFKTTSEKNIITQNLLQDFNRFLNTTFLFFPPFVSCIQEISCQHPDFLTLDPASVRVG
CLASLQQPGGIRLLEEALLRLMPKEPPTKRVRGKTCLPPDVLRWMELAKLYRSIGEYDVL
RGIFSSELGTTQDTQNALLAEARSDYCQAAKLYDEALNKLEWVDGEPTEAEKEFWELASL
DCYNNLSKWKELEYCSTVNIVSENSLDLSKMWSEPFYQETYLPYVIRSKLKLLLQGEGNQ
SLLTFVDEAMNKELQKTVLELQYSQELSLLYILQDDIDRATYYIKNGIQIFMQNYSSIDV
LLYRSRLAKLQSVQTLAEIEEFLSFICKHGDLSSLGPLRRLLKTWTSRYPDVVTDPMHIW
DDIITNRCFFLSKIEERLTAPSGDHSMSVDEDEESIDREVYEPKEDVRCMLQSCRFTMKM
KMIESAWKQSNFSLSMKLLKEMHKESKTREIWRVQWLHSYSQLNHCRSHTQSPREQVLNM
LKTITLLDESDISNYLNKNIQASCDQSILLGTTCRIMADALSREPACLSDLEENKVNSIL
TLSGSNAENTETVITGLYQRAFHHLSKAVQSAEEETQLSCWGHEAAAERAHAYMTLVGFC
DQQLRKVEESASQKTSAEMEAYPALVVEKMLRALKLNSSEARLKFPRLLQIIEQYSEETL
NIMTKEISSIPCWQFIGWISHMMALLDKEEAIAVQHTVEEIADNYPQAIIYPFIISSESY
SFKNTSSGHNNKAFVERIKSKLDHGEVIHSFINALDQLSNPDLLFKDWVSDTKDELGKNP
VNKKNIEKLYERMYAALGDLRAPGLGPFRRRFIQAFGKEFVKSFGNGGSKLLTMKVDDFC
KITGSLLVRMKKDSKLPGNLKEYSPWMSEFKAQFLKNELEIPGQYDGKSKPLPEYHVRIS
GFDERVKVMLSLRKPKRIVIRGHDEKEYPFLVKGGEDLRQDQRIEQIFEVMNAILSQDAA
CSQRNMQLRTYRVVPMTSRLGLIEWIENTMTLKDLLLSNMSQEEKVANNSDPKAPIRDYK
DWLMKVSGKSDAGAYVLMYSRANRTETVVAFRRRESQVPPDLLKRAFVKMSTSPEAFLAL
RSHFASSHALLCISHWLLGIGDRHLNNFMVAMETGSVIGIDFGHAFGSATQFLPVPELMP
FRLTRQFVSLMLPMKETGLMCTVMVHALRAFRSCAGLLTDTMEIFVKEPSFDWKSFEQTM
LRKGGSWIQEINVTEKNWYPQHKIRYAKRKLAGANPAVITCDELYLGHEASSAFRSYTAV
ARGNRDYNIRAQEPESGLSEETQVKCLVDQATDPNILGRTWEGWEPWM
NT seq 12387 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagggaaccggcgtacggtgttggctactgcagctgcaggagttcctgtcc
gcagcagaccgctgcagtgctgccggggccagttaccagctgattcgtagtctggggcag
gagtgcgtgctgagcactagctctgcagtgcaggcattgcagatttccttagttttttcc
agagactttggtttgcttgtgtttatccggaagtcgcttagcattgaggactttcgtgat
tgtagagaagaagccctaaagtttttatgtgttttcttagagaaaattgaccagaaggtt
atgcattactctcttgatattaagaatacttgtaccagtgtttacacaaaagatagaact
gctaagtgtaaaattccagccttagaccttctgattaagttacttcagatactaagaagt
accagactcatggatgaatttaagattggagaattatttaacaaattctatggagaactt
gcatcaaaatcaaaactacctgatacagttttagaaaaagtctatgagctcctgggagta
ttaggtgaagttcatcctagtgagatgataaaccattcagaaaacctgttccgagctttt
ctgggagaacttaagacccagatgacatccacagtaagagaacctaaatttcctgtctta
gctggctgtctgaagggactatcctcacttctgtgcaacttcactaagtccatggaagaa
gatccccagacttcaaaggaaatttttggttttacatttaaagcaattcgtcctcagatt
gagatgaagcgatatgctgtgcccttagctggcctacgattacttaccctgcatgcatct
caattcactgcctgccttctggacaactatattactttatttgaagtactgtctaagtgg
tgtagccatacaaatgtggaattaaaaaaagctgcacattcagccctggagtccttcctg
agacagatttcgtttactgtggcagaagatgcagagttgcataagagcaggctgaagtac
tttatggaacagttctatggaatcatcagaaatacagactcgaacaacaaggaattagcc
attgctattcgcggatatggactatttgcaggaccttgcaaggttataaatgcaaaagat
gttgacttcatgtacgtggagctcattcagcgctgtaagcagatgttcctcacccacgca
gatgcttctgaggatcatgtttaccagatgccaagtttccttcagtctattgcaagtgtc
ttgctttaccttgacacggttccggaggtatatactccagtactggaacatctcatggtg
gtacagatagacagcttccctcagtatagtcccaaaatgcagttggtgtgctgtaaagca
ataataaaacttttcctagccttatcagagaaaggaccagttcactggaattgcattagt
gctgtggtgcaccaaggtttaattagaatatgttctaaaccagtggtccttcaaaaggat
gttgagtctaggtctgataaccgttcggcctccgaggaagtcagaactggcaggtggaaa
gtacctacgtacaaagactatgtggatctttttcagcatcttttaggctgtgaccagatg
gaggattttattttaggagatgaaacatttctctttgtgaactcctcccttaaaagtctg
aatcatttactctatgatgaatttataagatcagttttgaagattgtggaaaaattggat
cttacactggaaaaacagactgttggagagcaggaggatggaagcactgctgatgtctgg
gtgatcccaacttcagatccagcagctaatttgcaccctgctaaaccaagtgatttttca
gctctcattaacctggtggagttttgcagggagattcttcctaggaaacatgtaggcttt
tttgagccatgggtgtactcatttgcatatgagttaattttgcagtctacacgattgcca
ctcatcagtggtttctacaaattgctttctattgcagtgaaaaatgccaggaaaataaaa
tattttgagggaatcagcccaaagagtctgaaacattctcctgaagatacagaaaagtat
tcttgctttgctttatttgcaaagtttggcaaagaggtatcagttaaaatgaagcaatac
aaggatgaactgttggcctcttgtttaacctttgttctgtccttgccacatgacatcatt
gaacttgatgttagagcctacgttcctgcattgcagatggctttcaagctgggcctgagc
catatgccactggcagaaataggtctacatgcccttaaagagtggtcagttcacattgat
aagtctatactgcagccttactacaaagacattctcccctgccttgatggatatctgaat
acttcaaccttatcagatgaaaccaagagccactggggattgtctgcactttctcgggct
gcccagaagggatttaatagacatgtagtgaagcatctaaaaaggactagaaatagttcg
cctgatgaagcactgtccttagaagagataagaattaaagtagtacaaatacttggctct
ctgggaggacaaataaacaaaagccttgtaacagctacatccggagaaaggatgaagaag
tacgtggcgtgggatgcggagagaagactcagctttgcagtgcccttcagagagatgaag
cctgtcatttatctggatgtctttctgcctcgggtcactgaattggctctttctgctagc
gaccgacaaactaaagtagcagcttgtgaactgttacacagcatggttatgtttatgttg
ggaagagcgactcagatgcctgaaggtcaggggttgccgcccatgtaccagctttataag
cacacgtttcctgtgctgcttcaacttgcgtgtgatgtggatcaagtgacaaggcagctc
tatgaaccgcttgttatgcagctgatccactggttgactaacaataaaaaatttgaaagt
caagatactgttgccttattagaagccatactggatggtattgtggaccctgttgacagt
actttaagagatttttgtggacggtgcgttcaagaattcctcaaatggtccattaagcaa
acaacacctcagcagcaagagaagagtccagtaaacagcaagtcacttttcaagcggctc
tacagccttgcacttcatcctaatgctttcaagaggctaggtgcagcacttgcttttaat
cacatctacaaggaattcagggaagaaggatccctggtagaacagtttgtgtttgaagcc
ttagtgacatatatggaaagtctggccttggcacatgaagatgagaaatccttaggcaca
gttcagcagtgctgtgatgccatcgatcacctaagacgcatcattgaaaagaagcatgtc
tctttaaacaaagcaaaaaagcgacgtttgccacagggatttccacctttgacatcatta
tgtttattggatctggtcgagtggcttttggctcactgtggaaggccccagacagaatgt
cgacacaagtccatggaactcttttataaatttgttcctttactgccaggcaacaaatcc
ccttctttatggttgaaagaccttataaaaaagaaaggtatttcttttctcataaacaca
tttgaaggaggggcaagcagcagtgatcagccagcaggcattcttgctcagccaaccctc
gtctacttacaagggccaatcagcctgcgaggagtgctacaatggctggacctcctcctt
gcagcactggagtgctacaacacatttattgagaaggagactgtgcaaggacaagaggtc
ctgggtgctgaagtacagtcttcacttttgaagtcagtggctttctttttagaaagcata
gcaacccatagcgctagagcagtagaacaacgctttggctccggggcgccgggccctccc
agcctccacgaggaagagaagtacaattacagcaagtgcacagtcttagtccggatcatg
gaattcaccacaaccctgctcatcgcctctccagaggactgcaagctcctggagaaggac
ttgtgtaatacaaatcttatgcaggtcttagtgaaaatgatctgtgagcccatgagctta
ggtttcaatattggcgatgtccaggttatgaaccatcttcccagcatttgtgtgaacctg
ctgaaagctcttaggaagtccccgtacagagacatgctggagactcacctgaaggagaaa
gtgacagtacagagtgttgaagagctctgttccattaacttgtgtagctctggggctcgc
caagaaaggtctaagttactttctatcttatcagcctgtaaacagcttcacaaagctggt
ttctctcatgttatatcaccatctcagtctacagcattgaaccattccgttggcatgaga
ctgctgtccttggtttataaaggcattgtgcctgcagaggaaaggcagtgcctgcagtct
ttggaccccagctgtaagagcctagccaatggactcctggaattagcctttggttttgga
ggactgtgtgaccatcttgtgagtttgctcctgaattcggcaatgctgtctacacaatat
ctgggcagttcacagagaaatattagcttctcccatggggaatatttctacagtttgttc
tcagaagtgatcaacagtgagctgttgaagaatcttgatattgctgtatcaaggctcatg
gagtcatcttcggataatcccaaaatggtgagcactgttttaaatggtatgctagacaca
agcttcagggatcgagctgttcagaaacaccaaggactgaagcttgcaactgcaattctg
cagaactggaggaagtgtgattcatggtgggccccagattctgccccagagagcaaaaca
actgtgctgtctttgctggcaaagatgttgcagattgattcagctttatcttttgataca
aatcacagctcattttctgaaatcttcacaacatacgctagtctacttgctgatacaaag
ttgggtctacacttaaagggccaagctatcattcttcttccattcttcaccagtcttaga
gaaggcagtctagaaaacctaaagcatattctggaaaaactcattgtttgcaatttcccc
atgaagtctgatgaatttcctcctgattccctaaagtacaataattatgtggactgcatg
aaaaagtttctagatgcactggagttatctcagagtcctatgttgtttcagttgatgaca
gatatactttgtcgggaacagcgacatattatggaagaattgttccaaaccactttcaaa
aggattgctaggcagagtccatgtgtcacacagttaaatcttctggaaagtgtgtacaca
atgttccggaaggctgacctcccttcaaatgtcactcgccaggcatttgtagatcgctct
ctcctcaccttgttgtggcactgtgacttggacacactgaaagagttctttagtagaatt
gtggtagatgccattgatgtgttgaagtccagatttacaaagctaaatgaatttactttt
gacactcaaatcaccaagaagatgtgctattacaagatgctagctgtgatgtattctcgt
cttttaaaagatgatgttcactctaaagaagctaaaattaatcaagcttttcatggctcc
cgtgttgcagaaggaaatgaactcacaaagacacttcttaagttgtgccatgatgcattt
acagagaacatggtgggggagagccagttgctggagaagagaagactttatcattgtgct
gcatacaactgtgccatttctctgataagctgtgtcttcaatgagttgaaattttaccaa
ggttttttatttaatgaaaaaccagaaaagaacttgtttatttttgaaaatttgatagac
ctgaaacgttgctatacatttcctatagaagttgaggttcctatggaaagaaagaaaaag
tacattgaaattaggaaagaggccagggatgcagcaaatggggcttcaggcagtcctcat
tatatgtcttcattgtcatatttgacagacagtagcctaagtgaagaaatgagtcaattt
gatttctcaactggagttcagagctattcatacagttctcaagatcgtaaacctaccact
ggccattttcagagacgggagcatcaagattccatgacccaggatgacatcatggagtta
gagatggatgagctcaatcaacatgaatgtatggctcccatgatagccctgattaagcac
atgcagagaaatgtgattgcacctaagggagaagagggttcaataccaaaagatcttcca
ccgtggatgaaatttcttcatgacaaactaggaaatgcatcagtatctttaaatatccgt
ctcttcttagccaagcttgttattaatacagaagaggtctttcgcccttatgcaaagcac
tggctcagccccctgctacagctagctgtttgcgagaacaacagagaaggaattcactac
atgatggtagaaatagtagctaccattctctcttggactggcttggctacacctacagga
gtccctaaagatgaagtgttagcaaatcgattgcttcgttttctaatgaagcatgtcttc
catcccaaaagagctgtgtttaggcacaaccttgaaattattaaaacccttgttgaatgc
tggaaggagtgtctttccatcccttacaggttaatatttgaaaaattttcccataaggac
cctaattctaaagacaattctgtgggaattcagttattaggcattgtgatagctaataac
ttgcctccctatgacccaaattgtgacataaccagtgccatgtattttgaagctttagtc
aataacatgtcctttgtgaagtataaagaagtatatgcagctgcagcagaagttttagga
cttattcttcaatacattactgagagaaaacacgtgatagcagagttggtatgtgaactg
gttataaaacaactgaagcaacatcaaaatactatggaagacaaatttattgtttgctta
aacaaaatagcgaagggcttccctcctcttgctgacaggttcttgaatgctttgttcttt
ctgctgccaaaatttcatggagtaatgaagacactttgtctggaagttgtactttgtcga
gcagaggagatcacaggcctatacttacagttaaagagtaaagactttcttcaagtcatg
agacatagagatgatgaaagacaaaaggtgtgtttggatatagtttataagatggtggca
aaattaaaaccaatagaactccgagaacttctgaatcctgttgtggaatttgtttcccat
ccttctccaacatgtagagaacaaatgtataatattcttatgtggattcatgacaattac
agagatcaagagagtcaaaatgatgaagattcccaggaaatatttaaactggcaaaagat
gtactgattcaaggactgatcgacgagaacgttggactccaactaattattcggaatttc
tggagccatgaaaccagattgccttccaatacattggaccgattgctggcattaaattct
ttatattcccccaagatagaagtccactttttaagtttagcaacaaactttctgcttgaa
atgaccaggatgagcccagattatctaaaccccatttttgagcatcctctgtcagaatgt
gaatttcaggaatatactatagatcctgactggcgttttcgtagtactgttcttactccg
atgtttattgagacccaggcctctccaagtattctccatacccaaacccaagaagggccc
ctctcagaccaaaggcagaagcctggacaagtgcgggccacccaacaacaatatgatttc
actccaacacaagcttcagttgaaaggagctcatttgattggctgactgggagcagcatt
gacctactggcggatcacaccgtcttctcttcagagaccttgtcttcctccttgctgttt
tcccacaaaaggactgaaaagtcacagagaatgtcttgtaagtcagtaggaccggacttt
ggaacaaaaaagctgggccttcctgatgatgaggtggataaccaagtgaaaagtggcact
ccgagccaggcagatattctgagattgcgcagaagatttttaaaggaccgagaaaagttg
agtttgctgtatgccaaaaggggcctcatggaacaaaaactagagaaggatatcaagagt
gagtttaaaatgaagcaggatgcgcaggttgttctgtacagaagttatcgtcatggcgat
cttcctgatatccagatccagcacagtggtctgatcacccccttgcaggctgtggcccag
aaagacccaataattgcaaaacaactcttcagcagcttgttttctgggattttgaaagaa
atgaataaatttaagacaacatctgaaaagaacatcatcactcaaaatttgctccaagat
ttcaaccgcttccttaatacaactttcttgttctttccaccctttgtctcttgcatccag
gaaataagttgccaacacccagacttcctgacacttgacccagcctcagttcgagtggga
tgcctggctagtctgcagcagccgggaggtatccgtcttctggaagaggccctactccgg
ctgatgcccaaggaaccacccaccaaaagagttcggggcaagacttgcttgcctcccgat
gttctccggtggatggaacttgctaaactctatcgttcgattggggagtatgatgttctc
cgtggcatttttagcagtgagttaggaacaacgcaggacactcagaacgcactattagca
gaagctagaagtgattattgtcaagctgctaagttgtatgatgaggctttaaataaactg
gagtgggtggatggtgaacccacagaagctgagaaggagttttgggagctggcatcgctt
gactgttacaacaacctctctaaatggaaagaacttgagtactgttctacagtcaatata
gtcagtgagaactctcttgacctaagtaaaatgtggagtgaaccattttatcaggagacg
tatctgccatatgtgatccgtagcaaactaaagctcctgcttcaaggagaaggcaaccaa
tctctgctaacatttgtggatgaagccatgaacaaggagctgcagaagacggtcctggag
cttcagtatagtcaagagctgagtcttctttacatcttgcaggatgatattgacagagcc
acatactacattaaaaatggcattcagattttcatgcaaaattattctagtattgatgtt
ctgttatatagaagtagactcgccaagttacagtctgtacagactttagcagaaattgag
gagttcctaagttttatatgtaaacatggtgacttatcatctctgggtcccctaaggaga
cttctaaaaacctggaccagcagatacccagatgttgtgacagacccaatgcacatctgg
gatgacatcatcacaaatcgctgcttctttctcagtaaaatagaagagagactgactgct
ccttcaggagatcacagtatgagtgtggatgaggatgaagagtccattgacagggaagtg
tacgagccaaaggaagatgttcgttgcatgcttcagagctgcagattcaccatgaaaatg
aagatgatagaaagcgcctggaagcagagtaatttctcactctccatgaaactcctgaaa
gagatgcataaagaatcaaaaacaagagaaatttggcgagtgcagtggttgcatagttac
tcccagctgaaccactgccggagccacactcagagccctcgggaacaagtcctcaatatg
ctcaaaaccatcacgctgttggatgaaagtgatatttcaaactacttaaataaaaacatt
caggcctcttgtgaccagagcattctcttgggcacaacttgcagaatcatggctgatgct
ctcagcagagagccagcctgcctgtctgacctggaggagaacaaggtgaactcaatcttg
acactttccggatctaatgcagagaacacagagacggtaatcacgggtctgtaccagaga
gcattccatcacctctccaaggccgtgcagtcagctgaagaggaaacccagctttcctgc
tggggccatgaggctgctgctgagcgggcccatgcttatatgacactggtaggcttctgt
gaccaacaactccgaaaggtagaagagagtgcctcacagaagacaagtgcagaaatggaa
gcatatccagcacttgtggtggaaaaaatgctgagagcattaaagttaaactcttctgaa
gccaggctgaaatttcctagattacttcagattatagagcagtattcagaggagacctta
aacataatgacaaaagagatttcatctattccttgctggcagttcattggctggatcagc
cacatgatggccttactggacaaagaggaagctattgcagtacaacatactgtggaagaa
attgctgataactacccacaggccattatctacccttttataataagcagcgaaagctac
tcctttaaaaacacttcttctggtcataacaataaagcatttgttgagaggataaaaagt
aaacttgatcacggagaagtgattcacagttttattaacgccttagaccagctctccaat
cctgacctgctcttcaaggactgggtttctgatacaaaagatgaactaggaaagaatcct
gtgaataagaaaaatattgaaaagttgtatgaaaggatgtatgctgccttgggtgacctt
cgtgctccaggcctggggccctttcggaggaggttcatacaggcgtttgggaaagaattt
gtcaagagctttgggaatggtggttctaagctgcttacaatgaaggtcgatgacttttgt
aagatcactggctcgctacttgtaaggatgaaaaaagactcaaagctacctgggaacctg
aaagagtattccccctggatgagtgagttcaaagcgcagttcctgaaaaatgaactggag
attcctggacaatatgatggaaaaagcaaaccactgcctgaatatcacgtgcggatctct
ggatttgatgagcgggtaaaagtgatgctctccttgaggaagccaaagcgcattgttatt
cgaggccatgatgaaaaggaatacccgttcctggtaaaaggtggtgaggacctccgtcaa
gaccagcgcattgagcagatctttgaggtcatgaatgccattctctctcaggatgctgcc
tgcagtcagagaaacatgcagttaaggacttaccgtgtcgtgccaatgacctctagatta
ggattaattgaatggattgaaaatactatgaccttgaaggatcttcttttgagtaatatg
tcacaagaggagaaagtggctaataacagtgaccccaaagcgccgatccgtgactataaa
gactggctgatgaaagtgtcggggaaaagcgatgctggagcctatgtgctaatgtacagc
cgagctaaccgtacagaaacagttgtagctttcagaagaagggaaagtcaagtgccgcct
gacctcttaaagcgggcctttgtaaagatgagcaccagccctgaggccttcctggcactg
cgttcccactttgccagctcccatgcactgctgtgcatcagccactggctcctcgggatt
ggagacagacacctgaacaatttcatggtggccatggagacaggcagtgtgattggaatt
gactttggacatgcgtttggatcagctactcagtttcttccagtccctgagttgatgcct
tttcgtctaacccgccaatttgtcagtctcatgttgccaatgaaagaaacgggtctcatg
tgcacggtcatggtgcatgcactgagggctttccgctcttgtgcaggtctgctcactgac
accatggaaatttttgtgaaggaaccctcctttgattggaagagttttgagcagacaatg
ctgagaaaaggaggatcatggattcaagaaataaatgtaacggaaaagaattggtatcca
caacataaaatacgctatgctaagagaaagttagcaggggccaacccagctgttataact
tgtgatgagctatatctaggccatgaagcttcatccgcctttaggagttatacagctgta
gctcgaggcaacagagactacaacattcgtgcacaagagccagagagtgggctttcagaa
gagactcaagtgaagtgcttggtggaccaggccacagaccccaatatccttggcaggact
tgggaaggatgggagccctggatgtaa

DBGET integrated database retrieval system