KEGG   Mus musculus (mouse): 20181Help
Entry
20181             CDS       T01002                                 

Gene name
Rxra, 9530071D11Rik, Nr2b1, RXRalpha1
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  
retinoid X receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    20181 (Rxra)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    20181 (Rxra)
   03320 PPAR signaling pathway
    20181 (Rxra)
   04919 Thyroid hormone signaling pathway
    20181 (Rxra)
  Digestive system
   04976 Bile secretion
    20181 (Rxra)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    20181 (Rxra)
   05202 Transcriptional misregulation in cancers
    20181 (Rxra)
   05216 Thyroid cancer
    20181 (Rxra)
   05222 Small cell lung cancer
    20181 (Rxra)
   05223 Non-small cell lung cancer
    20181 (Rxra)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    20181 (Rxra)
  Infectious diseases
   05160 Hepatitis C
    20181 (Rxra)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    20181 (Rxra)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   20181 (Rxra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 A3; 2 19.38 cM
AA seq 467 aa AA seqDB search
MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNG
VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctctacccaggtgaactcttcgtccctc
aactctccaacgggtcgaggctccatggctgtcccctcgctgcacccctccttgggtccg
ggaatcggctctccactgggctcgcctgggcagctgcactctcctatcagcaccctgagc
tcccccatcaatggcatgggtccgcccttctctgtcatcagctcccccatgggcccgcac
tccatgtcggtacccaccacacccacattgggcttcgggactggtagcccccagctcaat
tcacccatgaaccctgtgagcagcactgaggatatcaagccgccactaggcctcaatggc
gtcctcaaggttcctgcccatccctcaggaaatatggcctccttcaccaagcacatctgt
gctatctgtggggaccgctcctcaggcaaacactatggggtatacagttgtgagggctgc
aagggcttcttcaagaggacagtacgcaaagacctgacctacacctgccgagacaacaag
gactgcctgatcgacaagagacagcggaaccggtgtcagtactgccgctaccagaagtgc
ctggccatgggcatgaagcgggaagctgtgcaggaggagcggcagcggggcaaggaccgg
aatgagaacgaggtggagtccaccagcagtgccaacgaggacatgcctgtagagaagatt
ctggaagccgagcttgctgtcgagcccaagactgagacatacgtggaggcaaacatgggg
ctgaaccccagctcaccaaatgaccctgttaccaacatctgtcaagcagcagacaagcag
ctcttcactcttgtggagtgggccaagaggatcccacacttttctgagctgcccctagac
gaccaggtcatcctgctacgggcaggctggaacgagctgctgatcgcctccttctcccac
cgctccatagctgtgaaagatgggattctcctggccaccggcctgcacgtacaccggaac
agcgctcacagtgctggggtgggcgccatctttgacagggtgctaacagagctggtgtct
aagatgcgtgacatgcagatggacaagacggagctgggctgcctgcgagccattgtcctg
ttcaaccctgactctaaggggctctcaaaccctgctgaggtggaggcgttgagggagaag
gtgtatgcgtcactagaagcgtactgcaaacacaagtaccctgagcagccgggcaggttt
gccaagctgctgctccgcctgcctgcactgcgttccatcgggctcaagtgcctggagcac
ctgttcttcttcaagctcatcggggacacgcccatcgacaccttcctcatggagatgctg
gaggcaccacatcaagccacctag

DBGET integrated database retrieval system