KEGG   Mus musculus (mouse): 20181Help
Entry
20181             CDS       T01002                                 

Gene name
Rxra, 9530071D11Rik, Nr2b1, RXRalpha1
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04659  Th17 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04976  Bile secretion
mmu05160  Hepatitis C
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    20181 (Rxra)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    20181 (Rxra)
  Endocrine system
   04920 Adipocytokine signaling pathway
    20181 (Rxra)
   03320 PPAR signaling pathway
    20181 (Rxra)
   04919 Thyroid hormone signaling pathway
    20181 (Rxra)
   04928 Parathyroid hormone synthesis, secretion and action
    20181 (Rxra)
  Digestive system
   04976 Bile secretion
    20181 (Rxra)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    20181 (Rxra)
   05202 Transcriptional misregulation in cancers
    20181 (Rxra)
   05226 Gastric cancer
    20181 (Rxra)
   05216 Thyroid cancer
    20181 (Rxra)
   05222 Small cell lung cancer
    20181 (Rxra)
   05223 Non-small cell lung cancer
    20181 (Rxra)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    20181 (Rxra)
  Infectious diseases
   05160 Hepatitis C
    20181 (Rxra)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    20181 (Rxra)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   20181 (Rxra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 20181
NCBI-ProteinID: NP_035435
MGI: 98214
Ensembl: ENSMUSG00000015846
Vega: OTTMUSG00000012047
UniProt: P28700 A2AJP1 Q3UMU4
Structure
PDB: 

Jmol
Position
2 A3; 2 19.38 cM
AA seq 467 aa AA seqDB search
MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNG
VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctctacccaggtgaactcttcgtccctc
aactctccaacgggtcgaggctccatggctgtcccctcgctgcacccctccttgggtccg
ggaatcggctctccactgggctcgcctgggcagctgcactctcctatcagcaccctgagc
tcccccatcaatggcatgggtccgcccttctctgtcatcagctcccccatgggcccgcac
tccatgtcggtacccaccacacccacattgggcttcgggactggtagcccccagctcaat
tcacccatgaaccctgtgagcagcactgaggatatcaagccgccactaggcctcaatggc
gtcctcaaggttcctgcccatccctcaggaaatatggcctccttcaccaagcacatctgt
gctatctgtggggaccgctcctcaggcaaacactatggggtatacagttgtgagggctgc
aagggcttcttcaagaggacagtacgcaaagacctgacctacacctgccgagacaacaag
gactgcctgatcgacaagagacagcggaaccggtgtcagtactgccgctaccagaagtgc
ctggccatgggcatgaagcgggaagctgtgcaggaggagcggcagcggggcaaggaccgg
aatgagaacgaggtggagtccaccagcagtgccaacgaggacatgcctgtagagaagatt
ctggaagccgagcttgctgtcgagcccaagactgagacatacgtggaggcaaacatgggg
ctgaaccccagctcaccaaatgaccctgttaccaacatctgtcaagcagcagacaagcag
ctcttcactcttgtggagtgggccaagaggatcccacacttttctgagctgcccctagac
gaccaggtcatcctgctacgggcaggctggaacgagctgctgatcgcctccttctcccac
cgctccatagctgtgaaagatgggattctcctggccaccggcctgcacgtacaccggaac
agcgctcacagtgctggggtgggcgccatctttgacagggtgctaacagagctggtgtct
aagatgcgtgacatgcagatggacaagacggagctgggctgcctgcgagccattgtcctg
ttcaaccctgactctaaggggctctcaaaccctgctgaggtggaggcgttgagggagaag
gtgtatgcgtcactagaagcgtactgcaaacacaagtaccctgagcagccgggcaggttt
gccaagctgctgctccgcctgcctgcactgcgttccatcgggctcaagtgcctggagcac
ctgttcttcttcaagctcatcggggacacgcccatcgacaccttcctcatggagatgctg
gaggcaccacatcaagccacctag

DBGET integrated database retrieval system