KEGG   Mus musculus (mouse): 20264Help
Entry
20264             CDS       T01002                                 

Gene name
Scn10a, Nav1.8, PN3, SNS
Definition
(RefSeq) sodium channel, voltage-gated, type X, alpha
  KO
K04842  
voltage-gated sodium channel type X alpha
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   20264 (Scn10a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F4; 9 71.33 cM
AA seq 1957 aa AA seqDB search
MEFPFGSVGTTNFRRFTPESLAEIEKQIAAHRAAKKGRPKQRGQKDKSEKPRPQLDLKAC
NQLPRFYGELPAELVGEPLEDLDPFYSTHRTFIVLDKSRTISRFSATWALWLFSPFNLIR
RTAIKVSVHSWFSIFITVTILVNCVCMTRTDLPEKLEYAFTVVYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGAAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVRKLADVTILTVFCLSVFALVGLQLFKGNLKNKCIKNGTDPHKADNLSSEMAGDIFIK
PGTTDPLLCGNGSDAGHCPNDYVCRKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWERL
YQQTLRASGKMYMVFFVLVIFLGSFYLVNLILAVVTMAYEEQSQATIAEIEAKEKKFKEA
LEVLQKEQEVLAALGIDTTSLYSHNGSPLAPKNANERRPRVKSRMSEGSTDDNRSLQSDP
YNQRRMSFLGLSSGRRRASHSSVFHFRAPSQDVSFPDGILDDGVFHGDQESRRSSILLGR
GAGQAGPLPRSPLPQSPNPGPRRGEEGQRGVPTGELATGAPEGPALDAAGQKNFLSADYL
NEPFRAQRAMSVVSIMTSVIEELEESKLKCPPCLISLAQKYLIWECCPKWKKFKMVLFEL
VTDPFAELTITLCIVVNTVFMAMEHYPMTDAFDAMLQAGNIVFTVFFTMEMAFKIIAFDP
YYYFQKKWNIFDCVIVTVSLLELSTSKKGSLSVLRTFRLLRVFKLAKSWPTLNMLIKIIG
NSVGALGNLTFILAIIVFIFALVGKQLLSENYGCRRDGISVWNGERLRWHMCDFFHSFLV
VFRILCGEWIENMWVCMEVSQDYICLTLFLTVMVLGNLVVLNLFIALLLNSFSADNLTAP
EDDGEVNNLQVALARIQVFGHRASRAITSYIRSHCRLRWPKVETQLGMKPPLTSCKAENH
IATDAVNAAVGNLAKPALGGPKENHGDFITDPNVWVSVPIAEGESDLDELEEDVEHASQS
SWQEESPKGQELLQQVQKCEDHQAARSPPSGMSSEDLAPYLGERWQREESPRVPAEGVDD
TSSSEGSTVDCPDPEEILRKIPELAEELDEPDDCFPEGCTRRCPCCKVNTSKFPWATGWQ
VRKTCYRIVEHSWFESFIIFMILLSSGALAFEDNYLEEKPRVKSVLEYTDRVFTFIFVFE
MLLKWVAYGFKKYFTNAWCWLDFLIVNISLTSLIAKILEYSDVASIKALRTLRALRPLRA
LSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFSRCVDTRSNPFSV
VNSTFVTNKSDCYNQNNTGHFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSR
DINSQPNWEESLYMYLYFVVFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQK
KYYNAMKKLGSKKPQKPIPRPLNKYQGFVFDIVTRQAFDIIIMALICLNMITMMVETDNQ
SEEKTKVLGRINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVILSISSLLFSAIL
SSLESYFSPTLLRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFI
YSIFGMASFANVIDEAGIDDMFNFKTFGNSMLCLFQITTSAGWDGLLSPILNTGPPYCDP
NRPNSNGSKGNCGSPAVGILFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSEDD
FDMFYETWEKFDPEATQFIAFSALSDFADTLSGPLRIPKPNQNILIQMDLPLVPGDKIHC
LDILFAFTKNVLGESGELDSLKTNMEEKFMATNLSKASYEPIATTLRCKQEDISATIIQK
AYRNYMLQRSLMLSNPLHVPRAEEDGVSLPREGYVTFMANDNGGLPDKSETASATSFPPS
YDSVTRGLSDRANISTSSSMQNEDEVTAKEGKSPGPQ
NT seq 5874 nt NT seq  +upstreamnt  +downstreamnt
atggagttcccctttgggtccgtgggaactaccaacttcagacggttcactccagagtcg
ctggcagagatcgagaagcagatcgctgcccaccgcgccgccaagaagggcagacctaag
caaagaggacagaaggacaagagtgagaagcccaggcctcagttggacttgaaggcctgt
aaccagctgcccaggttctatggcgagctcccagcagagctggtcggggagcccctggag
gacctggatcctttctacagcacacaccggacattcatagtgttggataaaagcaggacc
atttccagattcagtgccacttgggctctgtggctcttcagtcccttcaacctgatcaga
agaacagccatcaaagtgtccgtccactcctggttctccatatttatcactgtcactatt
ttggtcaactgtgtgtgcatgacccgaactgatcttccagagaaactcgagtatgccttc
actgttgtttacaccttcgaggctctgataaagatactggcaagagggttttgtctaaat
gaattcacttatcttcgagatccctggaactggctggacttcagtgtcattaccctggcg
tatgtgggtgcagcgatagacctccgaggaatctcaggcctgcggacattccgagttctc
agggccctgaagactgtttctgtgatcccaggactgaaggtcatcgtgggagccctgatc
cactcagtgaggaagctggccgacgtgaccatcctcacagtcttctgcctgagtgtcttt
gccttggtgggcctgcagctcttcaaggggaacctcaagaataaatgcattaagaacggc
acagatccgcacaaggctgacaatctctcatctgaaatggcaggagacatcttcatcaag
cccggtactacggatcccttgttgtgtggcaatggatctgatgctggccactgccctaat
gattatgtctgccggaaaacttctgacaacccggattttaactacaccagctttgattcc
ttcgcgtgggcgttcctctcactgttccgtctcatgacgcaggactcctgggaacggctg
taccagcagacactccgggcttccgggaaaatgtacatggtcttttttgtgctggtcatc
ttccttggatcattctacctggtcaatttgatcttggctgtggtcaccatggcatatgag
gaacagagccaggcaacaattgcagaaatcgaagccaaggagaagaagttcaaggaagcc
ctcgaggtgctgcagaaagaacaggaggtgctggcagcgctgggcattgacacaacctcg
ctctattcccacaacggatcacccttagcccccaaaaacgccaatgagagaagacccagg
gtgaaatcaaggatgtcagaaggctcgacagatgacaacagatcactacaatccgaccct
tacaaccagcgcaggatgtctttcctaggcctttcttctggaagacgcagggctagccac
agcagtgtgttccacttccgagcacccagccaagacgtctcatttcctgatgggatcttg
gatgacggggtctttcatggagatcaggaaagccgtcgaagttccatattgctgggcagg
ggtgccgggcaggcaggtcctctccccaggagtccactgcctcagtcccccaaccctggc
cctagacgtggagaagagggacagcgtggagtgcccactggtgagcttgccactggagcg
cctgaaggcccggcactcgatgctgcaggacagaagaacttcctgtctgcagactacttg
aatgaacctttccgagcacagagggcaatgagtgttgtcagtattatgacttctgtcatt
gaggagctggaagagtctaagctgaagtgcccaccctgcttgatcagcttagcccagaag
tacctgatatgggagtgctgccccaagtggaagaaattcaagatggtgctcttcgagctg
gtgactgaccccttcgcagagctcaccatcaccctgtgcattgtggtgaataccgtcttc
atggccatggaacactaccccatgactgatgccttcgatgccatgctccaagccggcaac
attgtctttactgtgttttttacaatggagatggccttcaagatcattgccttcgacccc
tactactacttccagaagaagtggaacatcttcgactgtgtcatcgtcaccgtgagcctg
ctggagctgagcacatccaagaagggcagcttgtctgtgctccgcaccttccgcttgctt
cgggtcttcaagctggccaagtcctggcccaccctgaacatgctcatcaagatcatcggg
aactctgtgggggccctgggcaacctgaccttcatcctggccatcatcgtctttatcttc
gccctggtgggaaagcagctcctctcagagaactatgggtgccgcagggatggcatctcc
gtgtggaatggtgagaggctgcgctggcacatgtgtgacttcttccattccttcctcgtc
gtcttccggatcctctgcggggagtggatcgagaacatgtgggtctgcatggaggtcagc
caggactacatctgcctcaccctcttcttgacagtgatggtgctaggcaacctggtggtg
ctcaacctattcatcgctttactgctgaactccttcagtgcggacaacctcacagcccca
gaggatgacggggaggtgaacaacttgcaggtagcactggcccggattcaggtatttggc
catcgggccagtcgggccattaccagttacatcagaagccactgccggctccgctggccc
aaggtggagacccagctggggatgaaacccccactcaccagctgcaaagctgagaaccac
attgctactgatgctgtcaatgctgcagtggggaacctggcaaagccagctcttggtggc
cccaaggagaaccacggggacttcatcactgatcctaacgtgtgggtctctgtgcccatt
gctgagggggagtccgaccttgatgagctcgaggaagatgtggagcatgcttctcagagc
tcctggcaggaagagagccccaaagggcaggagctgctgcagcaagtccaaaagtgtgaa
gatcaccaggcagcccgaagcccaccctccgggatgtcctctgaggacctggctccatac
ctgggggagagatggcagagggaggagagccctcgggtccctgccgagggagtggatgac
acaagctcctccgagggcagcacggtggactgcccggacccagaggagatcctgaggaag
atccctgagctggcggaggagctggacgagcccgatgactgtttcccagaaggctgcact
cgccgctgtccctgctgcaaagtgaacaccagtaagtttccttgggccacgggctggcag
gtgcgcaaaacctgttaccgcattgtggagcacagctggtttgagagtttcattatcttc
atgatcctgctcagcagtggagcgctggcctttgaggataactacctggaagaaaagccc
cgagtgaagtctgtgctggagtacactgacagagtgttcaccttcatctttgtattcgag
atgttgctcaagtgggtagcttatggcttcaaaaaatatttcaccaatgcctggtgctgg
ctggacttcctcatcgtgaatatctccctcacaagcctcatagccaagatcctcgagtat
tcagacgtggcgtccatcaaagcccttcggactctccgtgccctccggccgctgcgggct
ctgtctcgattcgaaggcatgagggtagtggtggatgccttggtgggcgccattccctcc
atcatgaacgtcctcctcgtctgcctcatcttctggctcatcttcagcatcatgggtgtg
aacctcttcgccgggaaattttcgagatgtgtcgacaccagaagcaacccattttccgtc
gtgaattcgacattcgtgactaacaagtctgactgttacaatcaaaacaatactggccac
ttcttctgggttaacgtcaaagtcaacttcgacaacgttgctatgggctacctcgcgctt
ctccaggtggcaaccttcaaaggctggatggacattatgtatgcagctgtcgattctcga
gatatcaacagtcagcccaattgggaggagagcctgtacatgtacctatacttcgtcgtc
ttcatcattttcggtggcttcttcacgctgaatctctttgtcggggtcatcattgacaac
ttcaatcaacagaaaaaaaagctagggggccaggacatcttcatgacagaggagcagaag
aagtactacaatgccatgaagaagctgggctccaagaaaccccagaagcccatcccacgg
cctttgaataagtaccagggcttcgtgtttgacattgtgaccaggcaagcatttgacatc
atcatcatggctctcatctgcctcaacatgatcaccatgatggtggagaccgacaatcag
agcgaggagaagacgaaggtcctgggcagaatcaaccagttcttcgtggccgtcttcacg
ggcgagtgtgtgatgaagatgttcgcccttcggcagtattacttcaccaacggctggaat
gtgttcgacttcattgtggtgattctgtccatttctagtctgttgttttctgcgatcctt
agctcactagaaagttacttctcccccacgctcttacgcgtcatccgtctggccaggatc
ggccgcatcctcaggctgattcgagcagccaaggggattcgcacgctgctcttcgccctc
atgatgtccctgcccgccctcttcaacatcggcctcctcctcttcctcgtcatgttcatc
tactccatcttcggcatggccagcttcgctaatgtcatagatgaggctggcatcgacgac
atgttcaacttcaagacctttggcaacagcatgctgtgccttttccagatcaccacgtcg
gctggctgggatggcctcctcagccccatcctcaacacaggacccccctactgcgacccc
aaccggcccaacagcaatggctccaaggggaattgtggaagcccagcggtgggcatcctc
ttcttcaccacctacatcatcatctccttcctcatcgtggtcaacatgtacattgcagtg
attctggagaacttcaatgtggccacagaagagagcacggagcccctgagcgaggacgac
tttgacatgttctatgagacctgggagaagtttgacccggaggccacccagttcattgcc
ttttctgccctctcagactttgcagacacactctctggccctcttagaatcccaaaacct
aatcagaatatattaatccagatggacctgccgttggtccccggagataagatccactgt
ttggacatcctctttgccttcacaaagaatgtcttgggagaatctggggagttggattct
ctgaagactaatatggaagagaagtttatggcaactaatctttccaaagcatcctatgaa
ccaatagcaaccaccctccggtgcaagcaggaagacatctcagccaccattattcaaaag
gcctatcggaactacatgttgcaacgctccttgatgctctccaaccccctgcatgtgccc
agggctgaggaggatggcgtgtcactccccagggaaggctatgttacattcatggcaaat
gacaacggtgggctcccagacaaatcggaaactgcttctgctacgtctttcccaccatcc
tatgacagcgtcaccaggggcctgagtgacagggccaacattagcacatctagctcaatg
caaaatgaagatgaagtcactgctaaggaagggaagagccctggacctcagtga

DBGET integrated database retrieval system