KEGG   Mus musculus (mouse): 20454Help
Entry
20454             CDS       T01002                                 

Gene name
St3gal5, 3S-T, Siat9, [a]2
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (EC:2.4.99.9)
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    20454 (St3gal5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     20454 (St3gal5)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   20454 (St3gal5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6; 6 C3
AA seq 414 aa AA seqDB search
MHTEAVGGAARRPQKLRSQAAAPACRAMPSEFTSAKLRSDCSRTSLQWYTRTQHKMRRPS
LLIKDICKCTLVAFGVWLLYILILNYTAEECDMKRMHYVDPDRIKRAQSYAQEVLQKECR
PRYAKTAMALLFEDRYSINLEPFVQKVPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEH
DFPEHLRAKACKRCVVVGNGGILHGLELGHALNQFDVVIRLNSAPVEGYSEHVGNKTTIR
MTYPEGAPLSDVEYYANDLFVTVLFKSVDFKWLQAMVKNESLPFWVRLFFWKQVAEKVPL
QPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGVIAVVLATHLCDEVSLAGF
GYDLSQPRTPLHYFDSQCMGAMHWQVMHNVTTETKFLLKLLKEGVVEDLSGGIH
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcacacagaggcggtgggcggcgcggcgcggaggccccagaagctgcgaagccaagca
gcggcacctgcctgccgagcaatgccaagtgagttcacctctgcaaagctgagaagtgat
tgctcaaggacctccctgcaatggtacacccgaacccagcacaagatgagaagacccagc
ttgttaataaaagacatctgcaagtgcacgttggttgcatttggagtctggctcctgtac
atcctcattttgaattacaccgctgaagaatgtgacatgaaaagaatgcactatgtggac
cctgaccggataaagagagctcagagctatgctcaggaagtcttgcagaaggaatgtcgg
cccaggtacgcgaagacggctatggctctgttatttgaggacaggtacagcatcaacttg
gagccttttgtgcagaaggtccccacggccagtgaagctgagctcaagtatgacccgcct
tttggattccggaagttctccagtaaagtccagagcctcttggatatgctgcccgaacat
gactttcctgaacacttgagagccaaggcctgcaagcgctgtgtggttgttgggaacggg
ggcatcctgcacggactagagctgggtcacgccctcaaccagttcgatgtggtaataagg
ttgaacagtgcgccagttgagggttactctgaacacgttgggaataaaactactataagg
atgacttacccagagggtgcgccactgtcggacgttgaatactacgccaatgatttgttc
gttactgttttatttaagagtgttgatttcaagtggcttcaagcaatggtaaaaaatgaa
agcctgcccttttgggttcgcctcttcttttggaagcaagtggcagaaaaagtcccactc
cagccaaagcacttcaggattttgaacccagttatcatcaaagaaactgccttcgacatc
cttcagtactcagagcctcagtcaagattctggggccatgataagaacatccccacgatc
ggcgtcattgccgttgtcttggctacacatctgtgtgatgaagtcagcctggcaggcttt
ggctacgacctcagtcaacccaggacccctctgcactactttgacagtcagtgcatgggc
gccatgcactggcaggtcatgcacaatgtgaccacagagaccaagttcctcctgaagctc
ctcaaggagggcgtggtggaggacctcagcggcggcatccactga

DBGET integrated database retrieval system