KEGG   Mus musculus (mouse): 20525Help
Entry
20525             CDS       T01002                                 

Gene name
Slc2a1, Glut-1, Glut1
Definition
(RefSeq) solute carrier family 2 (facilitated glucose transporter), member 1
  KO
K07299  
MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
HIF-1 signaling pathway
Insulin secretion
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Bile secretion
HTLV-I infection
Pathways in cancer
Renal cell carcinoma
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    20525 (Slc2a1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    20525 (Slc2a1)
   04922 Glucagon signaling pathway
    20525 (Slc2a1)
   04920 Adipocytokine signaling pathway
    20525 (Slc2a1)
   04919 Thyroid hormone signaling pathway
    20525 (Slc2a1)
  Digestive system
   04976 Bile secretion
    20525 (Slc2a1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    20525 (Slc2a1)
   05230 Central carbon metabolism in cancer
    20525 (Slc2a1)
   05211 Renal cell carcinoma
    20525 (Slc2a1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    20525 (Slc2a1)
  Infectious diseases
   05166 HTLV-I infection
    20525 (Slc2a1)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   20525 (Slc2a1)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    20525 (Slc2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
4 D2.1; 4 55.34 cM
AA seq 492 aa AA seqDB search
MDPSSKKVTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWNHRYGEPIPSTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVAAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEEGRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLER
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatcccagcagcaagaaggtgacgggccgcctcatgttggctgtgggaggagcagtg
ctcggatcactgcagttcggctataacactggtgtcatcaacgccccccagaaggttatt
gaggagttctacaatcaaacatggaaccaccgctacggagagcccatcccatccaccaca
ctcaccacgctttggtctctctccgtggccatcttctctgtcgggggcatgattggttcc
ttctctgtcggcctctttgttaatcgctttggcaggcggaactccatgctgatgatgaac
ctgttggcctttgtggctgctgtgcttatgggcttctccaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgactactggctttgtg
cccatgtatgtgggagaggtgtcacctacagctctacgtggagccctaggcacactgcac
cagctgggaatcgtcgttggcatccttattgcccaggtgtttggcttagactccatcatg
ggcaatgcagacttgtggcctctgctgctcagtgtcatcttcatcccagccctgctacag
tgtatcctgttgcccttctgccccgagagcccccgcttcctgctcatcaatcgtaacgag
gagaaccgggccaagagtgtgctgaagaagcttcgagggacagccgatgtgacccgagac
ctgcaggagatgaaagaagagggtcggcagatgatgcgggagaagaaggtcaccatcttg
gagctgttccgctcacccgcctaccgccagcccatcctcatcgctgtggtgctgcagctg
tcccagcagctgtcgggtatcaatgctgtgttctactactcaacgagcatcttcgagaag
gcaggtgtgcagcagcctgtgtacgccaccatcggctccggtatcgtcaacacggccttc
actgtggtgtcgctgtttgttgtagagcgagctggacgacggaccctgcacctcattggc
ctggctggcatggcaggctgtgctgtgctcatgaccatcgccctggccttgctggaacgg
ctgccttggatgtcctatctgagcatcgtggccatctttggctttgtggccttctttgaa
gtaggccctggtcctattccatggttcattgtggccgagctgttcagccaggggccccgt
cctgctgctattgctgtggctggcttctccaactggacctcaaacttcattgtgggcatg
tgcttccagtatgtggagcaactgtgcggcccctacgtcttcatcatcttcacggtgctc
ctcgtgctcttcttcatcttcacctacttcaaagtccctgagaccaaaggccgaaccttc
gatgagatcgcttccggcttccggcaggggggtgccagccaaagtgacaagacacccgag
gagctcttccaccctctgggggcggactcccaagtgtga

DBGET integrated database retrieval system